DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and Rcvrn

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_033064.1 Gene:Rcvrn / 19674 MGIID:97883 Length:202 Species:Mus musculus


Alignment Length:193 Identity:102/193 - (52%)
Similarity:143/193 - (74%) Gaps:7/193 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSK---LKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDAS 62
            ||  |||   |..|:||:|:.||:||:.|:..||:.|||:||||.::.:||:.||..|||..|..
Mouse     1 MG--NSKSGALSKEILEELQLNTKFTEEELSAWYQSFLKECPSGRITRQEFESIYSKFFPDSDPK 63

  Fly    63 KFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTA 127
            .:|:||||:||||.|||:||:|::.||.:|:.||..|||:||||:||:||||.||:.|:||||.|
Mouse    64 AYAQHVFRSFDANSDGTLDFKEYVIALHMTTAGKPTQKLEWAFSLYDVDGNGTISKNEVLEIVMA 128

  Fly   128 IYKMV--GSVMKMPEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCDPQ 188
            |:||:  ..|..:|:||:|||||.:||:....:.:|.||:.||||||..::..|:||:|.:||
Mouse   129 IFKMIKPEDVKLLPDDENTPEKRAEKIWAFFGKKEDDKLTEEEFIEGTLANKEILRLIQFEPQ 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 89/167 (53%)
RcvrnNP_033064.1 FRQ1 14..182 CDD:227455 89/167 (53%)
EFh <37..90 CDD:298682 28/52 (54%)
EFh 65..127 CDD:238008 39/61 (64%)
EFh 101..175 CDD:238008 41/73 (56%)
Interaction with GRK1. /evidence=ECO:0000250|UniProtKB:P21457 189..192 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.