DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and ncs-7

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001360662.1 Gene:ncs-7 / 182694 WormBaseID:WBGene00015867 Length:239 Species:Caenorhabditis elegans


Alignment Length:175 Identity:53/175 - (30%)
Similarity:103/175 - (58%) Gaps:0/175 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDA 74
            |..::.|.:.|.|:..|||:.|:.|.:..|.|.:.:|:|:.||.:.||.||:..:||.||:..|.
 Worm    53 PPSIDYLIEITNFSKREIQQLYRSFKELWPIGTVDLEQFQLIYASIFPNGDSKGYAELVFKNIDQ 117

  Fly    75 NGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMP 139
            |..||:.|.:|:...|..::|.|:::|.|.|::||.:..|:::..|:..:|.::|:|:.|.:|..
 Worm   118 NRVGTVTFLDFITNYSKIAKGTLDERLDWIFTLYDTNRCGFLAYNEIFHVVKSMYQMMDSSLKPA 182

  Fly   140 EDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQ 184
            ...:...:....:|:.::...:||:|..||::..:||..|:..::
 Worm   183 VLATICRQHVKIVFKNLNIANNGKVSKAEFLQRCRSDSDILASME 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 51/165 (31%)
ncs-7NP_001360662.1 FRQ1 59..222 CDD:227455 51/162 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.