DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and ncs-6

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_494569.1 Gene:ncs-6 / 173700 WormBaseID:WBGene00021116 Length:338 Species:Caenorhabditis elegans


Alignment Length:218 Identity:39/218 - (17%)
Similarity:89/218 - (40%) Gaps:42/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTF- 72
            :|..|:.|.|.|.|....|...|:.|.:.|.:|.::..:::.::.:.||..:.|.|.:.::... 
 Worm    86 QPPGLDQLVQLTGFNRKWIMFMYRNFKQKCSNGRMTDSQWRILFRSIFPQANDSAFIDRLYAAIV 150

  Fly    73 DANGDGTIDFRE-FLCALSVTSRGKLEQ----------KLKWAFSMYDLDGNGYISRQEMLEIVT 126
            .......|.|.: .||...::..||..:          :.::||.:.|.:|.|.:......:...
 Worm   151 KKKQHPQITFEDLILCLWELSEDGKTSEMGNYHINSSARAQFAFQLMDEEGKGRVDEPGFYKYTR 215

  Fly   127 AIYKMV------------GSVMKMP----------EDESTP-----EKRTDKIFRQMDRNKDGKL 164
            .::.:.            .|.:.:|          :|...|     .:.:.|.|:::|.::||.:
 Worm   216 CVFALTAVNKPCTDQIIDASTIGLPASSIYRSTSVDDVLKPMSPLIARFSSKRFKELDTDRDGFI 280

  Fly   165 S---LEEFIEGAKSDPSIVRLLQ 184
            :   :|..:|..|::...::.|:
 Worm   281 TVRDIERELEIQKNEAICLKSLK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 37/207 (18%)
ncs-6NP_494569.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.