DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and Guca1a

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_032215.2 Gene:Guca1a / 14913 MGIID:102770 Length:202 Species:Mus musculus


Alignment Length:183 Identity:77/183 - (42%)
Similarity:110/183 - (60%) Gaps:21/183 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYG--NFFPYGDASKFAEHVFRTFDANGDGT 79
            |...|.:..|..:|||.|:.:||||.|::.||::.:|  |..|  .||::.|.:|.|||.|.||.
Mouse     8 KSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSP--SASQYVEQMFETFDFNKDGY 70

  Fly    80 IDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDEST 144
            |||.|::.|||:..:||:||||:|.|.:||:||||.|.|.|:|.|:.||    .::....:...:
Mouse    71 IDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIRAI----RTINPWSDSSMS 131

  Fly   145 PEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSD-------------PSIVRLLQ 184
            .|:.||.:|.::|.|.||:||||||:||.:.|             ..|||.||
Mouse   132 AEEFTDTVFAKIDINGDGELSLEEFMEGVQKDQMLLDTLTRSLDLTGIVRRLQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 72/176 (41%)
Guca1aNP_032215.2 FRQ1 12..163 CDD:227455 70/156 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.