DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and Gm21941

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001375392.1 Gene:Gm21941 / 100862348 MGIID:5439392 Length:166 Species:Mus musculus


Alignment Length:148 Identity:92/148 - (62%)
Similarity:105/148 - (70%) Gaps:10/148 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            |.||||||:||||:||:.:.||||.|:||||.|||.|||:|||:|:.| ||..|||||.||||..
Mouse     1 MDKQNSKLRPEVLQDLQNHKEFTDHELQEWYIGFLNDCPTGHLTVDNF-KIQHNFFPYRDASKLT 64

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            ||||.||..|.|.||:.|.|:.|:|:||.||||||:||||||.|||.|||||..||||||.|   
Mouse    65 EHVFHTFYTNSDSTINSRVFIIAVSMTSWGKLEQKVKWAFSMSDLDSNGYISCSEMLEIVQA--- 126

  Fly   131 MVGSVMKMPEDESTPEKR 148
                  |.|...||...|
Mouse   127 ------KCPWKNSTKVPR 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 82/136 (60%)
Gm21941NP_001375392.1 FRQ1 13..>125 CDD:227455 75/112 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.