DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and kcnip4a

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_021333732.1 Gene:kcnip4a / 100536963 ZFINID:ZDB-GENE-131003-3 Length:230 Species:Danio rerio


Alignment Length:176 Identity:72/176 - (40%)
Similarity:122/176 - (69%) Gaps:0/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFD 73
            :||.||.|:..|.|:..|:|..|:||..:||||.::.:.||:||..|||.||||.:|..:|..||
Zfish    49 RPEALEQLEAQTRFSRKELQILYRGFKNECPSGVVNEDTFKEIYAQFFPQGDASTYAHFLFNAFD 113

  Fly    74 ANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKM 138
            .:.:|::.|.:|:..||:..||.:::||.|||::||::.:|||:::|||:|:.:||.|:|.....
Zfish   114 TDHNGSVSFEDFVMGLSILLRGSVQEKLNWAFNLYDINKDGYITKEEMLDIIKSIYDMMGKCTYP 178

  Fly   139 PEDESTPEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQ 184
            ...|.||.:..:..|::||:|:||.::::|||:..::|.:|:|.:|
Zfish   179 ILKEETPRQHVEIFFQKMDKNRDGVVTIDEFIDCCQNDENIMRSMQ 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 67/165 (41%)
kcnip4aXP_021333732.1 FRQ1 53..219 CDD:227455 67/165 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.