DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and guca1b

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_002933553.1 Gene:guca1b / 100489509 XenbaseID:XB-GENE-22172599 Length:197 Species:Xenopus tropicalis


Alignment Length:190 Identity:84/190 - (44%)
Similarity:126/190 - (66%) Gaps:18/190 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFA 65
            :.:::||::.:|            ||:|||||.|:.:||||.|.:.|||:.:| .....:|:.:.
 Frog     5 LSEESSKVEIDV------------AELQEWYKKFVVECPSGTLFMHEFKRFFG-VADNQEAADYV 56

  Fly    66 EHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130
            ||:||.||.|||.||||.|::.||::..|||||.||||.|.:||.||||.|.:.|:||||.:||.
 Frog    57 EHMFRAFDKNGDNTIDFLEYVAALNLVLRGKLEHKLKWTFKVYDRDGNGCIDKAELLEIVESIYN 121

  Fly   131 MVGSVMKMPEDEST----PEKRTDKIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCD 186
            : ..|.:..:||.|    ||:..::||:.:|.|.||:|||:||::||:.|..::::||.|
 Frog   122 L-KKVCRRGQDERTPLLSPEEVVERIFQLVDENGDGQLSLDEFVDGARKDKWVMKMLQMD 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 78/169 (46%)
guca1bXP_002933553.1 FRQ1 1..166 CDD:227455 78/174 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.