DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nca and si:ch211-103a14.5

DIOPT Version :9

Sequence 1:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_002666176.1 Gene:si:ch211-103a14.5 / 100330921 ZFINID:ZDB-GENE-091204-414 Length:192 Species:Danio rerio


Alignment Length:187 Identity:67/187 - (35%)
Similarity:109/187 - (58%) Gaps:22/187 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREF 85
            |.:..|..:||:.|:.:||||.|:..||||.:|.......::::...:|:|||.|.||.|||.|:
Zfish    11 ELSACESHQWYRKFMTECPSGQLTFYEFKKFFGLKNLSEKSNEYVMTMFQTFDMNDDGCIDFMEY 75

  Fly    86 LCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTD 150
            :.|||:..:|.::|||:|.|.:||:||:|.|.|:|:|.||.||..:.|     .|.|.:.|:.|:
Zfish    76 VAALSLILKGGVQQKLRWYFKLYDVDGSGCIDREELLLIVKAIRAING-----VEQEVSAEEFTN 135

  Fly   151 KIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLL-----------------QCDPQSH 190
            .:|.::|.|.||.|:::||:||.::|..:..:|                 .|:.:.|
Zfish   136 MVFEKIDLNADGVLTMDEFMEGIQADEYLSTMLTQSLDLTHIVKKIYSEIHCEQEPH 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NcaNP_788543.1 FRQ1 13..179 CDD:227455 64/157 (41%)
si:ch211-103a14.5XP_002666176.1 EF-hand_8 29..79 CDD:290545 20/49 (41%)
EF-hand_7 55..112 CDD:290234 28/56 (50%)
EFh 58..116 CDD:238008 30/57 (53%)
EFh 90..159 CDD:238008 32/73 (44%)
EF-hand_7 91..158 CDD:290234 30/71 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.