DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14182 and mosmob

DIOPT Version :9

Sequence 1:NP_001262082.1 Gene:CG14182 / 40181 FlyBaseID:FBgn0036922 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001070129.1 Gene:mosmob / 767723 ZFINID:ZDB-GENE-060929-1030 Length:167 Species:Danio rerio


Alignment Length:166 Identity:84/166 - (50%)
Similarity:115/166 - (69%) Gaps:0/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKLTTISATLFMAADVFAIVSLALPDWIITESGTGDIRLGLMWTCMTLYNRPQVCYTPELQPEW 65
            |||||.||..||:|||:|||.|:|.||||.|....|.:.:||:..|.|::.|.::|.:|.|.|||
Zfish     1 MDKLTIISGCLFLAADIFAIASIANPDWINTGGQEGALTVGLVKQCQTIHGRNRICVSPSLPPEW 65

  Fly    66 LIALICIFVGCICVTTTVILLASSSCNRNVIPYARWVGFTAMVLFCMAAVVFPLGFHVEEIGGQA 130
            :..|..|.:|.:.:|.|..||..|...|....||||:.|..||||||||::||:||::.::|||.
Zfish    66 VTTLFFIILGIVSLTITCGLLVISHWRREATKYARWIAFMGMVLFCMAALIFPVGFYINQVGGQP 130

  Fly   131 YQLPNTFKIGISYIMFVLALWITVVSELFAGKVCLP 166
            |:|||...:|.||::|||:::.|:|..|||||||||
Zfish   131 YKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14182NP_001262082.1 Atthog 25..166 CDD:408571 65/140 (46%)
mosmobNP_001070129.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595747
Domainoid 1 1.000 158 1.000 Domainoid score I4090
eggNOG 1 0.900 - - E1_28XZS
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I3869
OMA 1 1.010 - - QHG52342
OrthoDB 1 1.010 - - D1466125at2759
OrthoFinder 1 1.000 - - FOG0006278
OrthoInspector 1 1.000 - - otm25943
orthoMCL 1 0.900 - - OOG6_108085
Panther 1 1.100 - - O PTHR31186
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4564
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.