DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14182 and Mosmo

DIOPT Version :9

Sequence 1:NP_001262082.1 Gene:CG14182 / 40181 FlyBaseID:FBgn0036922 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_006230243.3 Gene:Mosmo / 102547219 RGDID:7606925 Length:167 Species:Rattus norvegicus


Alignment Length:166 Identity:86/166 - (51%)
Similarity:115/166 - (69%) Gaps:0/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKLTTISATLFMAADVFAIVSLALPDWIITESGTGDIRLGLMWTCMTLYNRPQVCYTPELQPEW 65
            |||||.||..||:|||:|||.|:|.||||.|....|.:.:||:..|.|::.|.:.|..|.|.|||
  Rat     1 MDKLTIISGCLFLAADIFAIASIANPDWINTGESAGALTVGLVRQCQTIHGRDRTCIPPRLPPEW 65

  Fly    66 LIALICIFVGCICVTTTVILLASSSCNRNVIPYARWVGFTAMVLFCMAAVVFPLGFHVEEIGGQA 130
            :..|..|.:|.|.:|.|..||.:|...|....||||:.||.|:||||||::||:||::.|:|||.
  Rat    66 VTTLFFIIMGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIGFYINEVGGQP 130

  Fly   131 YQLPNTFKIGISYIMFVLALWITVVSELFAGKVCLP 166
            |:|||...:|.||::|||:::.|:|..|||||||||
  Rat   131 YKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14182NP_001262082.1 Atthog 25..166 CDD:408571 67/140 (48%)
MosmoXP_006230243.3 Atthog 25..166 CDD:408571 67/140 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4366
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16600
Inparanoid 1 1.050 147 1.000 Inparanoid score I4313
OMA 1 1.010 - - QHG52342
OrthoDB 1 1.010 - - D1466125at2759
OrthoFinder 1 1.000 - - FOG0006278
OrthoInspector 1 1.000 - - oto98449
orthoMCL 1 0.900 - - OOG6_108085
Panther 1 1.100 - - LDO PTHR31186
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4564
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.