DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and Gucy2g

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_001074545.1 Gene:Gucy2g / 73707 MGIID:106025 Length:1100 Species:Mus musculus


Alignment Length:268 Identity:77/268 - (28%)
Similarity:130/268 - (48%) Gaps:47/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 DYAPNLPMLFGEI-VMLASASVSG-------LYYRIMSDAAHNRTVDGTRTGIEQRVK-LECERE 261
            |.:|.|..:|..| ..|..||..|       :..::.:.|.|...|      :|:|.: |..|:.
Mouse   810 DESPELRPIFPSIKKTLREASPRGHVSILDSMMGKLETYANHLEEV------VEERTRELVAEKR 868

  Fly   262 QQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTILFADIVNF 326
            :.|:||.:::|:::..              |...|::         :..:...:|||.|:|||.|
Mouse   869 KVEKLLSTMLPSFVGE--------------QLIAGKS---------VEPEHFESVTIFFSDIVGF 910

  Fly   327 TPLSSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPI-SRPQHATNCVNMGL 390
            |.|.|..:...:||.||||:..||...|.:...:::.:||.|...||||| :..|||.....|.|
Mouse   911 TKLCSLSSPLQVVKLLNDLYSLFDHTIQSHDVYKVETIGDAYMVASGLPIRNGAQHADEIATMAL 975

  Fly   391 QMIDA-----IRHVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGVAG 450
            .::..     |.|:.|.   .:.:|||:|||.|:.||:|:...::.::.|.|.:|:.|||..:..
Mouse   976 HLLSVTTHFQIGHMPEE---RLKLRIGLHTGPVVAGVVGITMPRYCLFGDTVNMASRMESSSLPL 1037

  Fly   451 RVHITKQT 458
            |:|:::.|
Mouse  1038 RIHVSQST 1045

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 20/91 (22%)
CYCc 259..467 CDD:214485 62/206 (30%)
Guanylate_cyc 311..469 CDD:278633 55/154 (36%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
Gucy2gNP_001074545.1 PBP1_GC_G-like 47..436 CDD:380595
PK_GC 555..829 CDD:270894 6/18 (33%)
CYCc 865..1055 CDD:214485 62/207 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.