DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and grn

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_001072169.1 Gene:grn / 594884 XenbaseID:XB-GENE-995710 Length:1161 Species:Xenopus tropicalis


Alignment Length:31 Identity:12/31 - (38%)
Similarity:18/31 - (58%) Gaps:3/31 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1282 GYECECRGLTYVKGKGNL--VTYFVKTPFDG 1310
            |:.|:.|| |.|.|:.::  :|.....||||
 Frog   994 GFTCDARG-TCVLGQFSIPWLTKVPALPFDG 1023

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831
CYCc 259..467 CDD:214485
Guanylate_cyc 311..469 CDD:278633
BASP1 510..667 CDD:283191