DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and npr1a

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_001038402.1 Gene:npr1a / 560653 ZFINID:ZDB-GENE-060503-539 Length:1067 Species:Danio rerio


Alignment Length:247 Identity:75/247 - (30%)
Similarity:125/247 - (50%) Gaps:42/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 IEQRVK-LECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRH 313
            :|:|.: ...|:.:.|.||..::|..:|.::||..|::                       .:..
Zfish   838 VEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGEMVQ-----------------------AEAF 879

  Fly   314 TNVTILFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPISR 378
            .:|||.|:|||.||.||:..|..::|..||||:..||.|.......:::.:||.|..|||||:..
Zfish   880 DSVTIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRN 944

  Fly   379 PQ-HATNCVNMGLQMIDAIR--HVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLA 440
            .: ||.....|.|.:::|:.  .:|....:.:.:|||||:|.|..||:||:..::.::.|.|..|
Zfish   945 GKLHAREIARMSLALLEAVHSFRIRHRPNLQLRLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTA 1009

  Fly   441 NHMESGGVAGRVHITKQT-----------LDFLGDKFEVE-QGEGGNRDAYL 480
            :.|||.|.|.::|:::.|           |:..||   || :|:|..|..:|
Zfish  1010 SRMESNGEALKIHVSEATRAVLQEFNCFQLELRGD---VEMKGKGRMRTYWL 1058

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 11/39 (28%)
CYCc 259..467 CDD:214485 67/221 (30%)
Guanylate_cyc 311..469 CDD:278633 58/171 (34%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
npr1aNP_001038402.1 PBP1_NPR_A 48..449 CDD:107380
ANF_receptor 66..421 CDD:279440
PK_GC-A_B 540..814 CDD:270944
TyrKc 554..808 CDD:197581
HNOBA <823..868 CDD:285003 8/29 (28%)
CYCc 847..1032 CDD:214485 64/207 (31%)
Guanylate_cyc 874..1060 CDD:278633 64/211 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.