DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and ADCY10

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_060887.2 Gene:ADCY10 / 55811 HGNCID:21285 Length:1610 Species:Homo sapiens


Alignment Length:196 Identity:38/196 - (19%)
Similarity:78/196 - (39%) Gaps:33/196 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 VKLECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTI 318
            ::|.|..:...:|.:| :..|:...:     ||..|..|..|             ::.....|||
Human   249 LRLACTLKPDPELEMS-LQKYVMESI-----LKQIDNKQLQG-------------YLSELRPVTI 294

  Fly   319 LFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQ--ENQCLRIKIL--GDCYYCVSGLPISR- 378
            :|.:::    ......|.::...:.|.:.....:.:  :.|..::.:.  |..:.||.|.|..: 
Human   295 VFVNLM----FEDQDKAEEIGPAIQDAYMHITSVLKIFQGQINKVFMFDKGCSFLCVFGFPGEKV 355

  Fly   379 PQHATNCVNMGLQMIDAIRHVREATGINVDMRIGIHTGNVLCGVLG-LRKWQFDVWSDDVTLANH 442
            |...|:.:...:.:.|....|.:...::    ||:.:|.|.||::| ..:.::.|....|.||..
Human   356 PDELTHALECAMDIFDFCSQVHKIQTVS----IGVASGIVFCGIVGHTVRHEYTVIGQKVNLAAR 416

  Fly   443 M 443
            |
Human   417 M 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 7/34 (21%)
CYCc 259..467 CDD:214485 36/191 (19%)
Guanylate_cyc 311..469 CDD:278633 28/139 (20%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
ADCY10NP_060887.2 CHD 40..214 CDD:143636
AcyC <42..197 CDD:225025
CHD 292..461 CDD:143636 28/134 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.