Sequence 1: | NP_001246838.1 | Gene: | Ac76E / 40180 | FlyBaseID: | FBgn0004852 | Length: | 1312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060887.2 | Gene: | ADCY10 / 55811 | HGNCID: | 21285 | Length: | 1610 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 38/196 - (19%) |
---|---|---|---|
Similarity: | 78/196 - (39%) | Gaps: | 33/196 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 254 VKLECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTI 318
Fly 319 LFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQ--ENQCLRIKIL--GDCYYCVSGLPISR- 378
Fly 379 PQHATNCVNMGLQMIDAIRHVREATGINVDMRIGIHTGNVLCGVLG-LRKWQFDVWSDDVTLANH 442
Fly 443 M 443 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ac76E | NP_001246838.1 | AC_N | <67..289 | CDD:292831 | 7/34 (21%) |
CYCc | 259..467 | CDD:214485 | 36/191 (19%) | ||
Guanylate_cyc | 311..469 | CDD:278633 | 28/139 (20%) | ||
BASP1 | 510..667 | CDD:283191 | |||
CYCc | 1079..1283 | CDD:214485 | |||
Guanylate_cyc | 1101..1305 | CDD:278633 | |||
ADCY10 | NP_060887.2 | CHD | 40..214 | CDD:143636 | |
AcyC | <42..197 | CDD:225025 | |||
CHD | 292..461 | CDD:143636 | 28/134 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |