DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and npr1b

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:XP_009290669.2 Gene:npr1b / 555911 ZFINID:ZDB-GENE-100805-4 Length:1070 Species:Danio rerio


Alignment Length:248 Identity:73/248 - (29%)
Similarity:121/248 - (48%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 IEQRVK--LECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQR 312
            :|:|.:  || |:.:.|.||..::|..:|.::||.                       ..:..:.
Zfish   842 VEERTQAYLE-EKRKAEALLYQILPHSVAEQLKRG-----------------------ETVQAEA 882

  Fly   313 HTNVTILFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPIS 377
            ..:|||.|:|||.||.||:..|...:|..||||:..||.|.......:::.:||.|..|||||:.
Zfish   883 FDSVTIYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVR 947

  Fly   378 RPQ-HATNCVNMGLQMIDAIR--HVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTL 439
            ..: |......|.|.:::|::  .:|......:.:|||||:|.|..||:||:..::.::.|.|..
Zfish   948 NGKLHGREIARMSLALLEAVKTFKIRHRPDEQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNT 1012

  Fly   440 ANHMESGGVAGRVHITKQT-----------LDFLGDKFEVE-QGEGGNRDAYL 480
            ::.|||.|...::|::..|           |:..||   || :|:|..|..:|
Zfish  1013 SSRMESNGEPLKIHVSSATRAVLQEFNCFQLELRGD---VEMKGKGKMRTYWL 1062

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 12/40 (30%)
CYCc 259..467 CDD:214485 63/221 (29%)
Guanylate_cyc 311..469 CDD:278633 55/171 (32%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
npr1bXP_009290669.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.