DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and Gucy1a1

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_058786.2 Gene:Gucy1a1 / 497757 RGDID:68436 Length:690 Species:Rattus norvegicus


Alignment Length:276 Identity:78/276 - (28%)
Similarity:125/276 - (45%) Gaps:55/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 IVMLASASVS--------GLYYRIMSD-AAHNRTVDGTRTGIEQRVK------------------ 255
            |:.|.|..|.        |||   :|| ..||...|....|.:.|.:                  
  Rat   378 ILFLGSPCVDRLEDFTGRGLY---LSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEHAH 439

  Fly   256 --LECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTI 318
              ||.|:::...||.|:.|:.:|.::.:              ||. ..|.:|:|        ||:
  Rat   440 QALEEEKKKTVDLLCSIFPSEVAQQLWQ--------------GQI-VQAKKFNE--------VTM 481

  Fly   319 LFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPISRPQHAT 383
            ||:|||.||.:.|..:...::..||.|:.||||...|....:::.:||.|....||......||.
  Rat   482 LFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHRESDTHAV 546

  Fly   384 NCVNMGLQMIDAIRHVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGV 448
            ....|.|:|::....|....|..:.||||:|:|:|..||:|::..::.::.::|||||..||..|
  Rat   547 QIALMALKMMELSNEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSV 611

  Fly   449 AGRVHITKQTLDFLGD 464
            ..:::::..|...|.|
  Rat   612 PRKINVSPTTYRLLKD 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 22/99 (22%)
CYCc 259..467 CDD:214485 62/206 (30%)
Guanylate_cyc 311..469 CDD:278633 51/154 (33%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
Gucy1a1NP_058786.2 HNOB <111..234 CDD:285002
HNOBA 276..465 CDD:285003 22/89 (25%)
CYCc 444..633 CDD:214485 62/207 (30%)
Guanylate_cyc 471..642 CDD:278633 54/165 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.