DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and NPR3

DIOPT Version :10

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_001191304.1 Gene:NPR3 / 4883 HGNCID:7945 Length:541 Species:Homo sapiens


Alignment Length:253 Identity:53/253 - (20%)
Similarity:81/253 - (32%) Gaps:93/253 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SDSNQIIVSEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQAGAHYKYELLWIILVASCAALVI 94
            ||:||:      :..|.....||..           |:||   |..||            |..|:
Human  1100 SDTNQM------NTHNLAIVFGPTL-----------FQTD---GQDYK------------AGKVV 1132

  Fly    95 QSLAANLGVVTGKHLAEQCRAEYSKVPNFMLWVVAEIAVVACDIPEVIGTAFALNMLFSI----- 154
            :.|.::..||.... .|:.|.:..:|...:...||..|         .||..|.:.:.::     
Human  1133 EDLISHYVVVFSVD-EEELRKQREEVTAIVKMRVAGTA---------SGTQHAGDFICTVYLEEK 1187

  Fly   155 ------PVWIGVLLTGLS-TLILLALQKYGVRKLEFLIAFLVFTIAICFFVELHYSKPDPGEVLH 212
                  .|.|...:|... ||.:|..:...:|:.::.         .||.|.   .|.:....||
Human  1188 KVETEQHVKIPASMTAEELTLEILDRRNVSIREKDYW---------TCFEVN---EKEEAERPLH 1240

  Fly   213 GLFVPQLKGNGATGLAISLLGAMVMP--HNLFLHSALVLSRKIPRSASGIKEACRFYL 268
                               ....|:|  |.|.:.|.||: :|.|.     .||...||
Human  1241 -------------------FAEKVLPIVHGLGMDSHLVV-KKYPS-----MEAMLLYL 1273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AcyC 72..470 CDD:441717 43/211 (20%)
Guanylate_cyc 310..469 CDD:425528
Guanylate_cyc 1101..1305 CDD:425528
NPR3NP_001191304.1 PBP1_NPR_C 51..446 CDD:380609
TM_EphA1 476..507 CDD:214014
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.