DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and NPR2

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:XP_024303324.1 Gene:NPR2 / 4882 HGNCID:7944 Length:1103 Species:Homo sapiens


Alignment Length:414 Identity:112/414 - (27%)
Similarity:172/414 - (41%) Gaps:109/414 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LISGSILTALQFPAVLSS---PAAALAFAIVTTFS--LGTIAAITGDELAPLPMYALFLCIHSML 178
            |.|..:.||   |.:||.   |...:..|.|.:|.  |..||..:|      |.|          
Human   736 LFSEKLWTA---PELLSGNPLPTTGMQKADVYSFGIILQEIALRSG------PFY---------- 781

  Fly   179 PISWPVSVVLALFMTAIHIVYRI--GTSPDYAPNL--PMLFGEIVMLAS-------------ASV 226
                    :..|.::...||.::  |..|.:.|::  ..|..|:|:|..             ..:
Human   782 --------LEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPAERPDFGQI 838

  Fly   227 SGLYYRI---------------MSDAAHNRTVDGTRTGIEQRVK--LECEREQQEQLLLSVIPAY 274
            .|...|.               |...|:|     ....:|:|.:  || |:.:.|.||..::|..
Human   839 KGFIRRFNKEGGTSILDNLLLRMEQYANN-----LEKLVEERTQAYLE-EKRKAEALLYQILPHS 897

  Fly   275 IAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTILFADIVNFTPLSSSLTASDLV 339
            :|.::||.                       ..:..:...:|||.|:|||.||.||:..|...:|
Human   898 VAEQLKRG-----------------------ETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVV 939

  Fly   340 KTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPISRPQ-HATNCVNMGLQMIDAIR--HVRE 401
            ..||||:..||.|.......:::.:||.|..|||||....| ||.....|.|.::||:.  .:|.
Human   940 TLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRH 1004

  Fly   402 ATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGVAGRVHI---TKQTLDFLG 463
            .....:.:|||:|||.|..||:||:..::.::.|.|..|:.|||.|.|.::|:   ||..||.||
Human  1005 RPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELG 1069

  Fly   464 DKFEVE-------QGEGGNRDAYL 480
             .|::|       :|:|..|..:|
Human  1070 -CFQLELRGDVEMKGKGKMRTYWL 1092

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 44/208 (21%)
CYCc 259..467 CDD:214485 70/213 (33%)
Guanylate_cyc 311..469 CDD:278633 63/163 (39%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
NPR2XP_024303324.1 Periplasmic_Binding_Protein_Type_1 26..421 CDD:324556
PK_GC-A_B 521..848 CDD:270944 29/138 (21%)
HNOBA <857..902 CDD:311573 13/50 (26%)
CYCc 881..1065 CDD:214485 67/207 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.