DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and NPR1

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_000897.3 Gene:NPR1 / 4881 HGNCID:7943 Length:1061 Species:Homo sapiens


Alignment Length:264 Identity:81/264 - (30%)
Similarity:130/264 - (49%) Gaps:50/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 IEQRVK--LECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQR 312
            :|:|.:  || |:.:.|.||..::|..:|.::||.                       ..:..:.
Human   831 VEERTQAYLE-EKRKAEALLYQILPHSVAEQLKRG-----------------------ETVQAEA 871

  Fly   313 HTNVTILFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPIS 377
            ..:|||.|:|||.||.||:..|...:|..||||:..||.:.......:::.:||.|..|||||:.
Human   872 FDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVR 936

  Fly   378 RPQ-HATNCVNMGLQMIDAIR--HVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTL 439
            ..: ||.....|.|.::||:|  .:|......:.:|||||||.|..||:||:..::.::.|.|..
Human   937 NGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNT 1001

  Fly   440 ANHMESGGVAGRVHI---TKQTLDFLGDKFEVE-------QGEGGNRDAYLADHKVESYLIVPPK 494
            |:.|||.|.|.::|:   ||..|:..|. ||:|       :|:|          ||.:|.::..:
Human  1002 ASRMESNGEALKIHLSSETKAVLEEFGG-FELELRGDVEMKGKG----------KVRTYWLLGER 1055

  Fly   495 PAYT 498
            .:.|
Human  1056 GSST 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 12/40 (30%)
CYCc 259..467 CDD:214485 68/213 (32%)
Guanylate_cyc 311..469 CDD:278633 62/163 (38%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
NPR1NP_000897.3 PBP1_NPR_A 36..443 CDD:107380
ANF_receptor 54..414 CDD:279440
PK_GC-A_B 534..807 CDD:270944
TyrKc 547..801 CDD:197581
HNOBA <816..861 CDD:285003 10/30 (33%)
CYCc 840..1032 CDD:214485 70/216 (32%)
Guanylate_cyc 867..1053 CDD:278633 68/196 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.