powered by:
Protein Alignment Ac76E and AgaP_AGAP012805
DIOPT Version :9
Sequence 1: | NP_001246838.1 |
Gene: | Ac76E / 40180 |
FlyBaseID: | FBgn0004852 |
Length: | 1312 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001230271.1 |
Gene: | AgaP_AGAP012805 / 4397897 |
VectorBaseID: | AGAP012805 |
Length: | 55 |
Species: | Anopheles gambiae |
Alignment Length: | 46 |
Identity: | 21/46 - (45%) |
Similarity: | 29/46 - (63%) |
Gaps: | 0/46 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1259 MDSCGVMGRLQTTENTAKILMTAGYECECRGLTYVKGKGNLVTYFV 1304
|||.|:|..:|.||:..:|:...||...|||...|||||.::||.:
Mosquito 1 MDSTGLMDHIQVTEDVYQIVKDKGYNLTCRGTVNVKGKGTMITYLM 46
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2114 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D4253at7147 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.