DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ac76E and AgaP_AGAP012805

DIOPT Version :9

Sequence 1:	NP_001246838.1	Gene:	Ac76E / 40180	FlyBaseID:	FBgn0004852	Length:	1312	Species:	Drosophila melanogaster
Sequence 2:	XP_001230271.1	Gene:	AgaP_AGAP012805 / 4397897	VectorBaseID:	AGAP012805	Length:	55	Species:	Anopheles gambiae

Alignment Length:	46	Identity:	21/46 - (45%)
Similarity:	29/46 - (63%)	Gaps:	0/46 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly  1259 MDSCGVMGRLQTTENTAKILMTAGYECECRGLTYVKGKGNLVTYFV 1304
            |||.|:|..:|.||:..:|:...||...|||...|||||.::||.:
Mosquito     1 MDSTGLMDHIQVTEDVYQIVKDKGYNLTCRGTVNVKGKGTMITYLM 46

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ac76E	NP_001246838.1	AC_N	<67..289	CDD:292831
		CYCc	259..467	CDD:214485
		Guanylate_cyc	311..469	CDD:278633
		BASP1	510..667	CDD:283191
		CYCc	1079..1283	CDD:214485	9/23 (39%)
		Guanylate_cyc	1101..1305	CDD:278633	21/46 (46%)
AgaP_AGAP012805	XP_001230271.1	Nucleotidyl_cyc_III	<1..48	CDD:299850	21/46 (46%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2114
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D4253at7147
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.820