DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and Gyc89Db

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster


Alignment Length:304 Identity:78/304 - (25%)
Similarity:137/304 - (45%) Gaps:67/304 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1016 NDANITHGLPLEI--KGFLLLLVIILVLHTLDRQGEYVARTDFLWKAKLKVEQEEVETMRGINKI 1078
            ||.| .|||..|:  .|:                 ::.::.:.:::   |.||...|..:.:...
  Fly   413 NDLN-PHGLSRELVMAGW-----------------QHCSKLEIMFE---KEEQRSDELEKSLELA 456

  Fly  1079 ---------LLENILPAHVATHFLHLERSTELYHESYSCVAVMFASIPNYKEFYDETDVNKQ-GL 1133
                     ||.:::|..:|.   .:.:|.|...:|:..|:|:|..:.|   .||....|.| .:
  Fly   457 DSWKRQGDELLYSMIPRPIAE---RMRKSEEHVCQSFEEVSVIFIEVMN---IYDSGSNNIQDAM 515

  Fly  1134 ECLRLLNEIICDFDKLLLKPKFSGIEKIKTIASTYMCASG---LRPGKEDGATSRSFADEKRTEE 1195
            :.:..||::....|:.::.|   .:.|::|:...||..||   :.|...:.|...:....|:.:.
  Fly   516 QAVTTLNKVFSALDEEIISP---FVYKVETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKVKA 577

  Fly  1196 HNVVILVEFAIALMSILDSINRESFQRFRLRIGLNHGPVIAGVIGAQKPQYDIWSNTVNVASRMD 1260
            |          ||..:            .:|:|:|.|||:|||:|.:.|:|.::.:|||.||||:
  Fly   578 H----------ALPGV------------AIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRME 620

  Fly  1261 SCGVMGRLQTTENTAKILMTAGYECECRGLTYVKGKGNLVTYFV 1304
            |......:|.:..||..:...||:.|.||...|||||.:.||::
  Fly   621 SSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGEMETYWL 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831
CYCc 259..467 CDD:214485
Guanylate_cyc 311..469 CDD:278633
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485 54/207 (26%)
Guanylate_cyc 1101..1305 CDD:278633 60/208 (29%)
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 16/89 (18%)
Nucleotidyl_cyc_III 488..665 CDD:416391 60/205 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454053
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.