DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and Gyc89Da

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster


Alignment Length:352 Identity:86/352 - (24%)
Similarity:160/352 - (45%) Gaps:79/352 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   976 SLAAISAFLRSG--FILKLIAMLVAVIAQVTVLGYSDLFEMY------NDANITHGLPLEI--KG 1030
            |...:.:.|..|  |.:|.:..|:.:.:.:    ..:|.|::      ||.| .|||..|:  .|
  Fly   366 SSQGLRSILLKGQMFYIKDVDSLIFLCSPL----IENLDELHGIGLYLNDLN-PHGLSRELVMAG 425

  Fly  1031 FLLLLVIILVLHTLDRQGEYVARTDFLWKAKLKVEQEEVETMRGINKI---------LLENILPA 1086
            :                 ::.::.:.:::   |.||...|..:.:...         ||.:::|.
  Fly   426 W-----------------QHCSKLEIMFE---KEEQRSDELEKSLELADSWKRQGDELLYSMIPR 470

  Fly  1087 HVATHFLHLERSTELYHESYSCVAVMFASIPNYKEFYDETDVNKQG-LECLRLLNEIICDFDKLL 1150
            .:|.   .:..|.|...:|:..|:|:|..:.|   .|||...:.|| ::.:..||::....|:.:
  Fly   471 PIAE---RMRLSEEQVCQSFEEVSVIFLEVMN---VYDEGLNSIQGAMQTVNTLNKVFSALDEEI 529

  Fly  1151 LKPKFSGIEKIKTIASTYMCASG---LRPGKEDGATSRSFADEKRTEEHNVVILVEFAIALMSIL 1212
            :.|   .:.|::|:...||..||   :.|...:.|...:....|:.:.|:   :.:.||      
  Fly   530 ISP---FVYKVETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKFKAHD---MGDVAI------ 582

  Fly  1213 DSINRESFQRFRLRIGLNHGPVIAGVIGAQKPQYDIWSNTVNVASRMDSCGVMGRLQTTENTAKI 1277
                         |:|:|.|||:|||:|.:.|:|.::.:|||.||||:|.....::|.::.|...
  Fly   583 -------------RVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYTGDK 634

  Fly  1278 LMTAGYECECRGLTYVKGKGNLVTYFV 1304
            :...||:.|.||...|||||::.||::
  Fly   635 VRQVGYKVESRGTVQVKGKGDMETYWL 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831
CYCc 259..467 CDD:214485
Guanylate_cyc 311..469 CDD:278633
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485 54/207 (26%)
Guanylate_cyc 1101..1305 CDD:278633 60/208 (29%)
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 24/137 (18%)
CYCc 457..643 CDD:214485 56/216 (26%)
Guanylate_cyc 485..662 CDD:278633 60/205 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.