Sequence 1: | NP_001246838.1 | Gene: | Ac76E / 40180 | FlyBaseID: | FBgn0004852 | Length: | 1312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650507.1 | Gene: | CG14877 / 41929 | FlyBaseID: | FBgn0038380 | Length: | 254 | Species: | Drosophila melanogaster |
Alignment Length: | 224 | Identity: | 34/224 - (15%) |
---|---|---|---|
Similarity: | 81/224 - (36%) | Gaps: | 76/224 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 1062 LKVEQEEVETMRGINKILLENILPAHVATHFLHLERSTELYHESYSCVAVMFASIPNYKEFYDET 1126
Fly 1127 DVNKQGLECLRLLNEIICDFDKLLLKPKFSGIEKIKTIASTYMCASGLRPGKEDGATSRSFADEK 1191
Fly 1192 RTEEHNVVILVEFAIALMSILDSINRESFQRFRLRIGLNHGPVIAGVIGAQKPQYDIWSNTVNVA 1256
Fly 1257 SR--------MDSCGVM----GRLQTTEN 1273 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ac76E | NP_001246838.1 | AC_N | <67..289 | CDD:292831 | |
CYCc | 259..467 | CDD:214485 | |||
Guanylate_cyc | 311..469 | CDD:278633 | |||
BASP1 | 510..667 | CDD:283191 | |||
CYCc | 1079..1283 | CDD:214485 | 31/207 (15%) | ||
Guanylate_cyc | 1101..1305 | CDD:278633 | 28/185 (15%) | ||
CG14877 | NP_650507.1 | Periplasmic_Binding_Protein_Type_1 | 46..>241 | CDD:299141 | 34/224 (15%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |