DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and CG10738

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster


Alignment Length:528 Identity:120/528 - (22%)
Similarity:207/528 - (39%) Gaps:117/528 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 PMYALFLCIHSMLPISWPVSVVLALFMTAIHIVYRIGTSPDYAPNLPMLFGEIVMLASASVSGLY 230
            |:...|.|:...|...|                   ...|:..|:...:..::..|.......::
  Fly   814 PLETAFDCVSECLRECW-------------------AERPEDRPDFKTIRTKLRPLRKGMRPNIF 859

  Fly   231 YRIMSDAAHNRTVDGTRTGIEQRV-KLECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRA 294
            ..:|  |...:..:.....::.|. :|:.|:::.:.||..::|..:|.::|:.            
  Fly   860 DNMM--AMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKKG------------ 910

  Fly   295 GGQASTSATRFHELHVQRHTNVTILFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQCL 359
                       |::..:.:..|:|.|:|||.||.:|:..|...:|..||||:..||.|.......
  Fly   911 -----------HKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVY 964

  Fly   360 RIKILGDCYYCVSGLPISRPQ-HATNCVNMGLQMIDAIRH--VREATGINVDMRIGIHTGNVLCG 421
            :::.:||.|..|||||:.... ||.....|.|.::.|:..  :|......:.:|||||:|.|..|
  Fly   965 KVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAG 1029

  Fly   422 VLGLRKWQFDVWSDDVTLANHMESGGVAGRVHIT---KQTLDFLGDKFEVE------QGEGGNRD 477
            |:||:..::.::.|.|..|:.|||.||..::|.:   :|.||.||.....|      :|:|..|.
  Fly  1030 VVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRT 1094

  Fly   478 AYLADHKVESYLIVPPKPAYTYSVPRVVECIEQNDPSPTTEETKEIKET-DQSHEATDVADVLLP 541
            .:|.....|:      :...||         |::....:....|.|:.| .|:.|..:...:   
  Fly  1095 YWLLGEDEEA------RTRRTY---------ERSQRRGSRALNKFIQGTIKQAQEQANEYGI--- 1141

  Fly   542 VTVAPPPAIVDEKMSPTSINSQEAPLHAP--LASAASMSIKELSEEEDEADEATAVTEPLMHRDQ 604
                  .:.:.:|..|.:..::.:.|.:|  |..||...::......|||         |:..| 
  Fly  1142 ------RSSLKQKNLPRNSLTRSSSLESPKKLRFAAGSLLEHHRYHSDEA---------LLEVD- 1190

  Fly   605 DGKNDKEPKANGGHRGSGDSAAS--ESVAKSAALSLPADDLLSMSGSESGISNSGAQAQSSNPAS 667
                    ...|..|.||.|..|  |....|..||..:.:::            |.|.....|:|
  Fly  1191 --------SYTGLRRSSGGSTQSRYEETTLSLTLSCQSIEIV------------GGQHNKRRPSS 1235

  Fly   668 VTPTAAAP 675
            . |||..|
  Fly  1236 Y-PTANTP 1242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 18/123 (15%)
CYCc 259..467 CDD:214485 64/213 (30%)
Guanylate_cyc 311..469 CDD:278633 57/163 (35%)
BASP1 510..667 CDD:283191 30/161 (19%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944 8/57 (14%)
TyrKc 597..847 CDD:197581 7/51 (14%)
HNOBA <862..907 CDD:285003 9/46 (20%)
CYCc 886..1078 CDD:214485 64/214 (30%)
Guanylate_cyc 913..1099 CDD:278633 62/185 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.