DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and GUCY2C

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_004954.2 Gene:GUCY2C / 2984 HGNCID:4688 Length:1073 Species:Homo sapiens


Alignment Length:383 Identity:83/383 - (21%)
Similarity:159/383 - (41%) Gaps:112/383 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 VYRIGTSPDYAPNLPMLF--------GEIVMLAS--------------------ASVSGLYYRIM 234
            ::|:..|....|..|.||        .|:.:|..                    |.:.||::...
Human   692 IFRVENSNGMKPFRPDLFLETAEEKELEVYLLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQK 756

  Fly   235 SDA----------AHNRTVDGTRTGIEQRVKL-ECEREQQEQLLLSVIPAYIAAEVKRSIMLKMA 288
            :::          .::|.::..   :|:|.:| :.||::.::|...::|..:...:|....::  
Human   757 NESYMDTLIRRLQLYSRNLEHL---VEERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVE-- 816

  Fly   289 DACQRAGGQASTSATRFHELHVQRHTNVTILFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIA 353
                             .||:.:    |||.|:|||.||.:....|..::|..|||::..||.|.
Human   817 -----------------PELYEE----VTIYFSDIVGFTTICKYSTPMEVVDMLNDIYKSFDHIV 860

  Fly   354 QENQCLRIKILGDCYYCVSGLP-ISRPQHATNCVNMGLQMID-----AIRHVREATGINVDMRIG 412
            ..:...:::.:||.|...|||| .:..:||.:...|.|:::.     .:.|:   .|:.:.:|||
Human   861 DHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEILSFMGTFELEHL---PGLPIWIRIG 922

  Fly   413 IHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGVAGRVHITKQTL--------DFLGDKFEVE 469
            :|:|....||:|::..::.::.|.|..|:.|||.|:..|:|::..|:        .||   :||.
Human   923 VHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIHVSGSTIAILKRTECQFL---YEVR 984

  Fly   470 -----QGEGGNRDAYLADHKVESYLIVPPKPAYTYSVPRVVECIEQNDPSPTTEETKE 522
                 :|.|.....:|...|.:.:                      |.|:|.|.|.::
Human   985 GETYLKGRGNETTYWLTGMKDQKF----------------------NLPTPPTVENQQ 1020

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 20/129 (16%)
CYCc 259..467 CDD:214485 57/221 (26%)
Guanylate_cyc 311..469 CDD:278633 51/171 (30%)
BASP1 510..667 CDD:283191 5/13 (38%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
GUCY2CNP_004954.2 PBP1_GC_C_enterotoxin_receptor 35..415 CDD:107364
PK_GC-C 480..750 CDD:270946 9/57 (16%)
Pkinase_Tyr 502..745 CDD:285015 8/52 (15%)
CYCc 788..979 CDD:214485 55/216 (25%)
Guanylate_cyc 815..1002 CDD:278633 57/215 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.