DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and GUCY1B1

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:XP_011530203.1 Gene:GUCY1B1 / 2983 HGNCID:4687 Length:662 Species:Homo sapiens


Alignment Length:377 Identity:82/377 - (21%)
Similarity:139/377 - (36%) Gaps:139/377 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 TRTGIEQRVK--------LECEREQQ------------------EQLLLSVIPAYIAAEV--KRS 282
            |.||...|::        :.||::.:                  .:||.||:|..:|.|:  ||.
Human   390 TDTGCPARIQAFKVQTTLMLCEKDSRSTKGFPSISYSGFLLIPLNRLLYSVLPPSVANELRHKRP 454

  Fly   283 IMLKMADACQRAGGQASTSATRFHELHVQRHTNVTILFADIVNFTPLSSSLTASD----LVKTLN 343
            :..|                         |:.||||||:.||.|....|...:.:    :|..||
Human   455 VPAK-------------------------RYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLN 494

  Fly   344 DLFGRFDQIAQENQ---CLRIKILGDCYYCVSGLPISRPQHATNCVNMGLQMIDAIRHVREATGI 405
            ||:.|||.:....:   ..:::.:||.|..|||||.....||.:..::.|.|::....| :..|.
Human   495 DLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQV-QVDGE 558

  Fly   406 NVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGVAGRVHITKQTLDFLGDKFEVEQ 470
            :|.:.||||||.|:.||:|.|..::.::.:.|.|.:..|:.|..|::::::              
Human   559 SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSE-------------- 609

  Fly   471 GEGGNRDAYLADHKVESYLIVPPKPAYTYSVPRVVECIEQNDPSPTTEETKEIKETDQSHEATDV 535
                                      |||   |.:...|.:||              |.|.    
Human   610 --------------------------YTY---RCLMSPENSDP--------------QFHL---- 627

  Fly   536 ADVLLPVTVAPPPAIVDEKMSPTSINSQEAPLHAPLASAASMSIKELSEEED 587
                             |...|.|:..::.|:.....|..:...:|..:::|
Human   628 -----------------EHRGPVSMKGKKEPMQVWFLSRKNTGTEETKQDDD 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 16/70 (23%)
CYCc 259..467 CDD:214485 61/234 (26%)
Guanylate_cyc 311..469 CDD:278633 50/164 (30%)
BASP1 510..667 CDD:283191 11/78 (14%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
GUCY1B1XP_011530203.1 HNOB 2..166 CDD:311572
HNOBA 207..449 CDD:311573 12/58 (21%)
Guanylate_cyc 455..648 CDD:306677 64/296 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.