DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and GUCY1A2

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_001243353.1 Gene:GUCY1A2 / 2977 HGNCID:4684 Length:763 Species:Homo sapiens


Alignment Length:431 Identity:95/431 - (22%)
Similarity:161/431 - (37%) Gaps:164/431 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 IVMLASASVS--------GLYYRIMSD-AAHNRTVD--------GTRTGIEQRV----------- 254
            |:.|.|..|.        ||:   :|| ..|:.|.|        ..:.|:::|:           
Human   419 ILFLGSPCVDKLDELMGRGLH---LSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTH 480

  Fly   255 -KLECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTI 318
             .||.|:::...||.|:.|..:|.::.:              ||         ::..::..:||:
Human   481 QALEEEKKKTVDLLYSIFPGDVAQQLWQ--------------GQ---------QVQARKFDDVTM 522

  Fly   319 LFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQC-----LRIKILGDCYYCVSGLPISR 378
            ||:|||.||.:.:..|...::..||:|:.|||     :||     .:::.:||.|...:||....
Human   523 LFSDIVGFTAICAQCTPMQVISMLNELYTRFD-----HQCGFLDIYKVETIGDAYCVAAGLHRKS 582

  Fly   379 PQHATNCVNMGLQMIDAIRHVREATGINVD-------------------------------MRIG 412
            ..||.....|.|:|::....|....|..:.                               ||||
Human   583 LCHAKPIALMALKMMELSEEVLTPDGRPIQPQRSELLFSFPVSIQLVPDQHQSETDLGTEKMRIG 647

  Fly   413 IHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGVAGRVHITKQTLDFLGDKFEVEQGEGGNRD 477
            ||:|:||.||:|:|..::.::.::||||:..|||....|::::..|                   
Human   648 IHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTT------------------- 693

  Fly   478 AYLADHKVESYLIVPPKPAYTYSVPRVVECIEQNDPSPTTEETKEIKETDQSHEATDVADVLLPV 542
                      |.::..:.::|: :||..|.:..|.|       |||..          ....|.|
Human   694 ----------YQLLKREESFTF-IPRSREELPDNFP-------KEIPG----------ICYFLEV 730

  Fly   543 TVAPPPAIVDEKMSPTSINSQEAPLHAPLASAASMSIKELS 583
            ...|.|                     |..|.:|..||::|
Human   731 RTGPKP---------------------PKPSLSSSRIKKVS 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 21/99 (21%)
CYCc 259..467 CDD:214485 60/243 (25%)
Guanylate_cyc 311..469 CDD:278633 52/193 (27%)
BASP1 510..667 CDD:283191 15/74 (20%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
GUCY1A2NP_001243353.1 HNOB <159..270 CDD:285002
HNOBA 316..503 CDD:285003 20/86 (23%)
CYCc 485..705 CDD:214485 61/276 (22%)
Guanylate_cyc 514..729 CDD:278633 62/266 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.