DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and Npr3

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:XP_006232107.1 Gene:Npr3 / 25339 RGDID:3196 Length:652 Species:Rattus norvegicus


Alignment Length:271 Identity:55/271 - (20%)
Similarity:89/271 - (32%) Gaps:63/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 IAQENQCLRIKILGDCYYCVSGLPISRPQHATNCVNMGLQMIDAIRHVREATGINVDMRIGIHTG 416
            ||:|:..|....|....:|..|.|            .|.|.....:...|...:....|.....|
  Rat    57 IAEESSSLSFGALLKGVFCFLGAP------------KGAQGQRKEKSREERGRVGGGQRASRWPG 109

  Fly   417 NVLCGVLGLRKWQFDVWSDDVTLANHMESGGVAGRVHITKQTLDFLGDKFEVEQGEGG---NRDA 478
            ..|.| ..:|......:|..|.||..:.:||.:...          ||     .|.|.   .|:|
  Rat   110 RALAG-NRMRSLLLFTFSACVLLARALLAGGASSGG----------GD-----TGPGNRRREREA 158

  Fly   479 YLADHKVESYLIVPPKPAYTYSVPRV-------VECIEQNDPS-----PTTEETKEIKETDQSHE 531
             ||..|:|..:::|...:|.:|:.||       :..:|.|...     |.|......:::|..:.
  Rat   159 -LAAQKIEVLVLLPRDDSYLFSLARVRPAIEYALRSVEGNGTGRKLLPPGTRFQVAYEDSDCGNR 222

  Fly   532 AT-DVADVLLPVTVAPPPAIVDEKMSPTSINSQEAPLHAPLASAASMSIKELSEEED-EADEATA 594
            |. .:.|.:.....|.|..|:                 .|:...|:..:..|:...| ....|.|
  Rat   223 ALFSLVDRVAAARGAKPDLIL-----------------GPVCEYAAAPVARLASHWDLPMLSAGA 270

  Fly   595 VTEPLMHRDQD 605
            :.....|:|.:
  Rat   271 LAAGFQHKDTE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831
CYCc 259..467 CDD:214485 24/114 (21%)
Guanylate_cyc 311..469 CDD:278633 24/116 (21%)
BASP1 510..667 CDD:283191 17/103 (17%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
Npr3XP_006232107.1 PBP1_NPR_C_like 165..556 CDD:107381 24/134 (18%)
ANF_receptor 182..535 CDD:279440 20/117 (17%)
TM_EphA1 587..618 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.