DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and Gucy1b1

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_036901.2 Gene:Gucy1b1 / 25202 RGDID:2769 Length:619 Species:Rattus norvegicus


Alignment Length:408 Identity:94/408 - (23%)
Similarity:154/408 - (37%) Gaps:145/408 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 IVMLASASV--------SGLYYRIMSD-AAHNRTVDGTRTGIEQRVK------------------ 255
            |:.|.|.||        .|||   :|| ..|:.|.|....|.:.|.:                  
  Rat   319 ILFLCSPSVMNLDDLTRRGLY---LSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTL 380

  Fly   256 --LECEREQQEQLLLSVIPAYIAAEV--KRSIMLKMADACQRAGGQASTSATRFHELHVQRHTNV 316
              ||.|:::.:.||.||:|..:|.|:  ||.:..|                         |:.||
  Rat   381 RALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAK-------------------------RYDNV 420

  Fly   317 TILFADIVNFTPLSSSLTASD----LVKTLNDLFGRFDQIAQENQ---CLRIKILGDCYYCVSGL 374
            ||||:.||.|....|...:.:    :|..||||:.|||.:....:   ..:::.:||.|..||||
  Rat   421 TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGL 485

  Fly   375 PISRPQHATNCVNMGLQMIDAIRHVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTL 439
            |.....||.:..::.|.|::....| :..|.:|.:.||||||.|:.||:|.|..::.::.:.|.|
  Rat   486 PEPCIHHARSICHLALDMMEIAGQV-QVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNL 549

  Fly   440 ANHMESGGVAGRVHITKQTLDFLGDKFEVEQGEGGNRDAYLADHKVESYLIVPPKPAYTYSVPRV 504
            .:..|:.|..|::::::                                        |||   |.
  Rat   550 TSRTETTGEKGKINVSE----------------------------------------YTY---RC 571

  Fly   505 VECIEQNDPSPTTEETKEIKETDQSHEATDVADVLLPVTVAPPPAIVDEKMSPTSINSQEAPLHA 569
            :...|.:||              |.|.                     |...|.|:..::.|:..
  Rat   572 LMSPENSDP--------------QFHL---------------------EHRGPVSMKGKKEPMQV 601

  Fly   570 PLASAASMSIKELSEEED 587
            ...|..:...:|.:::|:
  Rat   602 WFLSRKNTGTEETNQDEN 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 28/101 (28%)
CYCc 259..467 CDD:214485 61/216 (28%)
Guanylate_cyc 311..469 CDD:278633 50/164 (30%)
BASP1 510..667 CDD:283191 11/78 (14%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
Gucy1b1NP_036901.2 HNOB 2..166 CDD:285002
HNOBA 207..406 CDD:285003 24/89 (27%)
CYCc 385..584 CDD:214485 69/281 (25%)
Guanylate_cyc 412..605 CDD:278633 64/296 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.