DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and Gucy1a2

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_001028494.1 Gene:Gucy1a2 / 234889 MGIID:2660877 Length:730 Species:Mus musculus


Alignment Length:389 Identity:91/389 - (23%)
Similarity:156/389 - (40%) Gaps:131/389 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 IVMLASASVS--------GLYYRIMSD-AAHNRTVD--------GTRTGIEQRV----------- 254
            |:.|.|..|.        ||:   :|| ..|:.|.|        ..:.|:::|:           
Mouse   417 ILFLGSPCVDKLDELMGRGLH---LSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTH 478

  Fly   255 -KLECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTI 318
             .||.|:::...||.|:.|..:|.::.:              ||         ::..::..:||:
Mouse   479 QALEEEKKKTVDLLYSIFPGDVAQQLWQ--------------GQ---------QVQARKFDDVTM 520

  Fly   319 LFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQC-----LRIKILGDCYYCVSGLPISR 378
            ||:|||.||.:.:..|...::..||:|:.|||     :||     .:::.:||.|...|||....
Mouse   521 LFSDIVGFTAICAQCTPMQVISMLNELYTRFD-----HQCGLLDIYKVETIGDAYCVASGLHRKS 580

  Fly   379 PQHATNCVNMGLQMIDAIRHVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLANHM 443
            ..||.....|.|:|::....|....|..:.||||||:|:||.||:|:|..::.::.::||||:..
Mouse   581 LCHAKPIALMALKMMELSEEVLTPDGKAIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKF 645

  Fly   444 ESGGVAGRVHITKQTLDFLGDKFEVEQGEGGNRDAYLADHKVESYLIVP----------PKPAYT 498
            |||....|::::..|...|                    .:.:|:..:|          ||    
Mouse   646 ESGSHPRRINVSPTTYQLL--------------------KREDSFTFIPRSREELPDNFPK---- 686

  Fly   499 YSVPRVVECIE-QNDPSPTTEETKEIKETDQSHEATDVADVLLPVTVAPPPAIVDEKMSPTSIN 561
             .:|.|...:| :.||.|                              |.|::...::...|.|
Mouse   687 -EIPGVCYFLELRTDPKP------------------------------PKPSLSSSRIKKVSYN 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 21/99 (21%)
CYCc 259..467 CDD:214485 62/212 (29%)
Guanylate_cyc 311..469 CDD:278633 54/162 (33%)
BASP1 510..667 CDD:283191 7/52 (13%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
Gucy1a2NP_001028494.1 HNOB <157..268 CDD:285002
HNOBA 314..501 CDD:285003 20/86 (23%)
CYCc 483..672 CDD:214485 63/236 (27%)
Guanylate_cyc 512..696 CDD:278633 60/213 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.