DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and gcy-34

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_506319.1 Gene:gcy-34 / 191656 WormBaseID:WBGene00001554 Length:686 Species:Caenorhabditis elegans


Alignment Length:326 Identity:87/326 - (26%)
Similarity:153/326 - (46%) Gaps:71/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1020 ITHGLPLEIKGFLLLL-----VIILV---------------------LHTLDRQGEYVAR---TD 1055
            :|.|..|::||.:::|     :|.|.                     ||...|....:.:   :|
 Worm   333 LTQGCHLKLKGQMMMLSTKKHIIYLCSPYVTSINELMQFGMRLTAMPLHDATRDLILLNQQRLSD 397

  Fly  1056 FLWKAKLKVEQEEVETM-------RGINKILLENILPAHVATHFLHLERSTELYHESYSCVAVMF 1113
            .....:|:...|::|||       |.....:|:::||..:|...|..|......:|:    .|||
 Worm   398 VEVNLQLEANNEQLETMTHELEVERQKTDSILKDMLPRKIAKQLLSGEHLEPCEYEA----TVMF 458

  Fly  1114 ASIPNYKEFYDETDVNKQGLECLRLLNEIICDFDKLLLKPKFSGIEKIKTIASTYMCASGLRPGK 1178
            ..:|.:::.....    |....::||||:....|::::   ..|:.|::|::.:||..||:    
 Worm   459 CDLPAFQQIIPVC----QPKNIVKLLNEVFFKLDRIVV---LRGVYKVETVSDSYMTVSGI---- 512

  Fly  1179 EDGATSRSFADEKRTEEHNVVILVEFAIALM----SILDSINRESFQRFRLRIGLNHGPVIAGVI 1239
                       ...|.|| ...:...|:.:|    |::|.:|:..   |.|||||:.|.:||||:
 Worm   513 -----------PDYTSEH-AENMCHVALGMMWEARSVMDPVNKTP---FLLRIGLHSGTIIAGVV 562

  Fly  1240 GAQKPQYDIWSNTVNVASRMDSCGVMGRLQTTENT-AKILMTAGYECECRGLTYVKGKGNLVTYF 1303
            |.:.|:|.::..||.:||:|:|.||.|::|.:..| :|.:.|..:|...||...|||:|::.|||
 Worm   563 GTKMPRYCLFGETVTLASQMESLGVAGKIQCSSWTYSKAMETGRFEFSPRGRINVKGRGDVETYF 627

  Fly  1304 V 1304
            :
 Worm   628 L 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831
CYCc 259..467 CDD:214485
Guanylate_cyc 311..469 CDD:278633
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485 59/208 (28%)
Guanylate_cyc 1101..1305 CDD:278633 63/209 (30%)
gcy-34NP_506319.1 HNOB 3..167 CDD:285002
HNOBA 224..441 CDD:285003 22/107 (21%)
CYCc 421..609 CDD:214485 60/217 (28%)
Guanylate_cyc 453..629 CDD:278633 63/206 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.