DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and gcy-23

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_500309.3 Gene:gcy-23 / 191652 WormBaseID:WBGene00001548 Length:1073 Species:Caenorhabditis elegans


Alignment Length:366 Identity:87/366 - (23%)
Similarity:160/366 - (43%) Gaps:73/366 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 MYALFLCIHSML------PISWPVSVVL-------ALFMTAIHIVYRI------------GTSPD 206
            :||..:.:|.:|      |....||.|:       ..|...:|...:|            ..:|:
 Worm   728 IYAFGMVMHEILFRALPFPNGTNVSEVMDYIRDGTKTFRPTVHDRTQIHPDLVALLLDCWNENPE 792

  Fly   207 YAPNL--PMLFGEIVMLASASVSGLYYRIMSDAAHN-RTVDGTRTGIEQRVKLECEREQQEQLLL 268
            ..|::  ..|..|..:....|:.....|:|...|:| ..:...|||:     ||....:.::||.
 Worm   793 VRPSIRRVRLNTENYLKVKGSLVDQMMRMMEQYANNLEKLVAERTGM-----LEEANVRADKLLG 852

  Fly   269 SVIPAYIAAEVK--RSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTILFADIVNFTPLSS 331
            .::|.|:|.|:|  ||:..|..|.                         .|::|:|||.||.:.|
 Worm   853 QLLPKYVANELKMGRSVPAKTFDM-------------------------ATVMFSDIVGFTTICS 892

  Fly   332 SLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPISR-PQHATNCVNMGLQMIDA 395
            |.|..::|..||.::.:||....::...:::.:||.|..|||:|... .:|..|..|..|:::..
 Worm   893 SSTPLEVVSMLNSIYSKFDDAINKHGSYKVETIGDAYMIVSGIPEENGNEHIRNICNTALELMLL 957

  Fly   396 IR--HVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGVAGRVHITKQT 458
            ::  .:.....:.:.:|:|||||.|..||:||...::.::.|.|.:|:.|||.....::.::::.
 Worm   958 LKTYEIPHRRNVKLRIRLGIHTGTVAAGVVGLTAPRYCLFGDTVNVASRMESTSEPEKIQMSQEA 1022

  Fly   459 LDF---LGDKFEV-------EQGEGGNRDAYLADHKVESYL 489
            .||   ...:|::       .:|:|.....:|...:.||.:
 Worm  1023 RDFCVRYYSEFQITLRGTVEAKGKGPVTSYWLLGKQSESQM 1063

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 35/151 (23%)
CYCc 259..467 CDD:214485 56/215 (26%)
Guanylate_cyc 311..469 CDD:278633 46/170 (27%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
gcy-23NP_500309.3 Periplasmic_Binding_Protein_Type_1 38..407 CDD:299141
ANF_receptor 38..385 CDD:279440
PK_GC 509..806 CDD:270894 14/77 (18%)
HNOBA <817..863 CDD:285003 14/50 (28%)
CYCc 842..1035 CDD:214485 57/217 (26%)
Guanylate_cyc 869..1056 CDD:278633 51/211 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.