DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and gcy-17

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_001293327.1 Gene:gcy-17 / 191649 WormBaseID:WBGene00001542 Length:1088 Species:Caenorhabditis elegans


Alignment Length:232 Identity:72/232 - (31%)
Similarity:120/232 - (51%) Gaps:33/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 IEQRVK-LECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRH 313
            :.:|.| |..|:::.:.||..::|..:|.::|..|.::                ....||     
 Worm   837 VNERTKELVEEQKKSDVLLYRMLPKTVAEKLKAGISIE----------------PETFEL----- 880

  Fly   314 TNVTILFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLP-IS 377
              |||.|:|:|.||.|:|..|...:|:.||||:..||.|.::|...:::.:||.|.|||||| .:
 Worm   881 --VTIFFSDVVQFTTLASKCTPLQVVQLLNDLYTIFDSIIEQNDVYKVETIGDGYLCVSGLPHRN 943

  Fly   378 RPQHATNCVNMGLQMIDAIRHVREA--TGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLA 440
            ...|..:...|.|..:.::...|.|  ....:::||||:.|:|:.||:||...::.::.|.|..|
 Worm   944 GHDHIKHIARMSLAFLSSLAEFRVAHMPSERINLRIGINCGSVVAGVVGLTMPRYCLFGDAVNTA 1008

  Fly   441 NHMESGGVAGRVHITKQTLDFL-----GDKFEVEQGE 472
            :.|||.|..||:|::.:....|     |.:.| |:||
 Worm  1009 SRMESNGKPGRIHVSSEANHLLTHVVGGFRTE-ERGE 1044

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 10/39 (26%)
CYCc 259..467 CDD:214485 65/215 (30%)
Guanylate_cyc 311..469 CDD:278633 57/165 (35%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
gcy-17NP_001293327.1 Periplasmic_Binding_Protein_Type_1 25..404 CDD:299141
ANF_receptor 47..398 CDD:279440
PKc_like 539..808 CDD:304357
Pkinase 567..803 CDD:278497
HNOBA <824..867 CDD:285003 8/29 (28%)
CYCc 846..1038 CDD:214485 65/214 (30%)
Guanylate_cyc 873..1060 CDD:278633 62/196 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.