DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and gcy-5

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_496219.1 Gene:gcy-5 / 191643 WormBaseID:WBGene00001532 Length:1122 Species:Caenorhabditis elegans


Alignment Length:449 Identity:103/449 - (22%)
Similarity:185/449 - (41%) Gaps:112/449 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 VTTFSLGTIAAITGDELAPLPMYALF---------LCIHSMLPIS--WPVSVVLALFMT------ 193
            :|.|.||.:.    :|..|.....|:         |.||.|.|.:  :..:::.:..:|      
 Worm   691 LTDFGLGALL----EEHTPSKKRLLWAAPEVLRGSLTIHQMDPSADVYSFAIIASEILTKREAWD 751

  Fly   194 -------AIHIVYRI--GTSPDYAPNLPM-------------------------------LFGEI 218
                   |..|:|.:  |.:....|.|.:                               |..|:
 Worm   752 ISNRKEGADEILYMVKKGGNRTIRPELILDAEVSPRLTTLVKDCWSEQPEDRPKAEQICKLLSEM 816

  Fly   219 VMLASASVSGLYYRIMSDAAHNRTVDGTRTGIEQRVK-LECEREQQEQLLLSVIPAYIAAEVKRS 282
            ....:.::....:.::.:......||     ||:|.| |..|:::.:.||..::|..:|..:|  
 Worm   817 TPRGNTNLMDHVFNMLEEYTSTLEVD-----IEERTKELTLEKKKADILLSRMLPKQVAERLK-- 874

  Fly   283 IMLKMADACQRAGGQASTSATRFHELHVQRHTNVTILFADIVNFTPLSSSLTASDLVKTLNDLFG 347
                        .||.         :..:....||:||:|:|.||.|::..:...:|..||||:.
 Worm   875 ------------AGQT---------VEPEGFDTVTVLFSDVVKFTQLAAKCSPFQVVNLLNDLYS 918

  Fly   348 RFDQIAQENQCLRIKILGDCYYCVSGLPISRP-QHATNCVNMGLQMID-----AIRHV-REATGI 405
            .||.|.:|:...:::.:||.|.||||||.... .|....|:|.|:.:|     .:.|: ||    
 Worm   919 NFDTIIEEHGVYKVESIGDGYLCVSGLPTKNGYAHIKQIVDMSLKFMDYCKSFKVPHLPRE---- 979

  Fly   406 NVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGVAGRVHITKQTLDFLGDKFEVEQ 470
            .|::||||::|..:.||:||...::.::.|.|..|:.|||.|....:|:::.....|.|.:. .|
 Worm   980 KVELRIGINSGPCVAGVVGLSMPRYCLFGDTVNTASRMESNGKPSMIHMSEAAHSLLTDHYP-HQ 1043

  Fly   471 GEGGNRDAYLADHK--VESYLIV-----PPKPAYTYSVPRVVECIEQNDPSPTTEETKE 522
            .|..:|...:...|  :|::.::     ..|...|.:.|.:.   ::|.|....|:.|:
 Worm  1044 YETSSRGEVIIKGKGVMETFWVLGKTDSDTKSLSTRTTPPIT---DENWPPQMKEDLKK 1099

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 34/200 (17%)
CYCc 259..467 CDD:214485 63/214 (29%)
Guanylate_cyc 311..469 CDD:278633 55/164 (34%)
BASP1 510..667 CDD:283191 4/13 (31%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
gcy-5NP_496219.1 PBP1_NPR_GC_like 30..440 CDD:107347
ANF_receptor 49..426 CDD:279440
PK_GC 546..816 CDD:270894 20/128 (16%)
HNOBA <830..873 CDD:285003 12/47 (26%)
CYCc 852..1042 CDD:214485 63/217 (29%)
Guanylate_cyc 879..1067 CDD:278633 60/192 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.