DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and Npr3

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:158 Identity:36/158 - (22%)
Similarity:63/158 - (39%) Gaps:44/158 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1103 HESYSCVAVMFASIPNYKEFYDE--TDVNKQGLECLRLLNEIICDF-DKLLLKPKFSGIEKIKTI 1164
            :.|...|.::....|.:::|..|  :.|.||||.....:|..:..| |.:||             
Mouse   311 YSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNEEDYVNMFVEGFHDAILL------------- 362

  Fly  1165 ASTYMCA--SGLRPG--KEDGAT------SRSF----------ADEKRTEEHNVVILVEFAIALM 1209
               |:.|  ..||.|  |:||..      :|:|          |:..|..:.:||.:.:......
Mouse   363 ---YVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVVAMTDTEAGTQ 424

  Fly  1210 SIL-DSINRESFQRFRLRIGLNH--GPV 1234
            .:: |...:|.  ||::|..:.:  ||:
Mouse   425 EVIGDYFGKEG--RFQMRSNVKYPWGPL 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831
CYCc 259..467 CDD:214485
Guanylate_cyc 311..469 CDD:278633
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485 36/158 (23%)
Guanylate_cyc 1101..1305 CDD:278633 36/158 (23%)
Npr3NP_032754.2 PBP1_NPR_C_like 49..440 CDD:107381 33/146 (23%)
ANF_receptor 66..419 CDD:279440 29/123 (24%)
TM_EphA1 471..502 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.