DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and Npr3

DIOPT Version :10

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:158 Identity:36/158 - (22%)
Similarity:63/158 - (39%) Gaps:44/158 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1103 HESYSCVAVMFASIPNYKEFYDE--TDVNKQGLECLRLLNEIICDF-DKLLLKPKFSGIEKIKTI 1164
            :.|...|.::....|.:::|..|  :.|.||||.....:|..:..| |.:||             
Mouse   311 YSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNEEDYVNMFVEGFHDAILL------------- 362

  Fly  1165 ASTYMCA--SGLRPG--KEDGAT------SRSF----------ADEKRTEEHNVVILVEFAIALM 1209
               |:.|  ..||.|  |:||..      :|:|          |:..|..:.:||.:.:......
Mouse   363 ---YVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVVAMTDTEAGTQ 424

  Fly  1210 SIL-DSINRESFQRFRLRIGLNH--GPV 1234
            .:: |...:|.  ||::|..:.:  ||:
Mouse   425 EVIGDYFGKEG--RFQMRSNVKYPWGPL 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AcyC 72..470 CDD:441717
Guanylate_cyc 310..469 CDD:425528
Guanylate_cyc 1101..1305 CDD:425528 36/158 (23%)
Npr3NP_032754.2 PBP1_NPR_C 46..441 CDD:380609 33/147 (22%)
TM_EphA1 471..502 CDD:214014
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.