DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and odr-1

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_001362115.1 Gene:odr-1 / 181479 WormBaseID:WBGene00003848 Length:1047 Species:Caenorhabditis elegans


Alignment Length:238 Identity:71/238 - (29%)
Similarity:118/238 - (49%) Gaps:29/238 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1068 EVETMRGINKILLENILPAHVATHFLHLERSTELYHESYSCVAVMFASIPNYKEFYDETDVNKQG 1132
            :::|||     ||..:|||.:|.   .|:....:...||....|||..|.::......:...   
 Worm   805 QMQTMR-----LLNEMLPASIAK---DLKNGLIMPPRSYESATVMFVQICDFNALMKRSSPE--- 858

  Fly  1133 LECLRLLNEIICDFDKLLLKPKFSGIEKIKTIASTYMCASGLRPGKEDGATSRSFADEKRTEEHN 1197
             :.:..||:|...||.::   |.....|::|...|||.|||: |.:.:|......|:        
 Worm   859 -QVIAFLNDIYDQFDTVI---KRHDAYKVETTGETYMVASGV-PHENEGRHIFEVAE-------- 910

  Fly  1198 VVILVEFAIALMSILDSINRESFQRFRLRIGLNHGPVIAGVIGAQKPQYDIWSNTVNVASRMDSC 1262
                :...|..:|.:..:..:...:.|:|||.:.||:.|||||.:.|:|.::.:|||.||||.|.
 Worm   911 ----ISLEIREISYIYVLQHDKNYKLRIRIGFHAGPIAAGVIGIRSPRYCLFGDTVNFASRMQSN 971

  Fly  1263 GVMGRLQTTENTAKILMTA-GYECECRGLTYVKGKGNLVTYFV 1304
            ....::||:|.||::|..: .|:...||:.:|||||.:..|::
 Worm   972 CPPNQIQTSEITARLLFDSHEYKFVKRGIVHVKGKGEVNCYWL 1014

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831
CYCc 259..467 CDD:214485
Guanylate_cyc 311..469 CDD:278633
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485 59/204 (29%)
Guanylate_cyc 1101..1305 CDD:278633 61/205 (30%)
odr-1NP_001362115.1 Periplasmic_Binding_Protein_type1 63..378 CDD:385651
PK_GC 495..768 CDD:270894
CYCc 803..996 CDD:214485 63/218 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.