DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and gcy-18

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_502449.2 Gene:gcy-18 / 178237 WormBaseID:WBGene00001543 Length:1113 Species:Caenorhabditis elegans


Alignment Length:303 Identity:83/303 - (27%)
Similarity:141/303 - (46%) Gaps:60/303 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 SPDYAPNL--PMLFGEIVMLASASVSGLYYRIMSDAAHN-RTVDGTRTGIEQRVKLECEREQQEQ 265
            :|:..|::  ..|..|:|:....|:.....::|...|:| ..:...|||:     ||....:.:|
 Worm   830 NPEIRPSIRRVRLNTEMVLKTKGSLVDQMMKMMEQYANNLEKLVAERTGM-----LEEANIRADQ 889

  Fly   266 LLLSVIPAYIAAEVK--RSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTILFADIVNFTP 328
            ||..::|||:|.|:|  ||:..|:                         :::.||||:|||.||.
 Worm   890 LLTQLLPAYVANELKMGRSVAPKL-------------------------YSSATILFSDIVGFTT 929

  Fly   329 LSSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPISRP-QHATNCVNMGLQM 392
            :.|..|..::|..||.|:..||:....|:..:::.:||.|..|||:|.... .|:.|..|..|.|
 Worm   930 ICSGSTPLEVVNMLNGLYTGFDECITRNKSYKVETIGDAYMVVSGIPEENEYNHSRNIANTALDM 994

  Fly   393 IDAIRHVREATGI--------NVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGVA 449
            ...:      ||.        .|..|.|.|||:|..||:||...::.::.|.|.:::.|||.|..
 Worm   995 RQYL------TGYQIPHRPTHRVRCRWGFHTGSVAAGVVGLTCPRYCLFGDTVNVSSRMESTGTP 1053

  Fly   450 GRVHITKQT---------LDFLGDKFEVE-QGEGGNRDAYLAD 482
            |.:.::::.         :....::.||: :|:|..|..:|.|
 Worm  1054 GMIQMSEEAHMHIRAHHPVFTTTERGEVQVKGKGTCRTFWLED 1096

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 26/89 (29%)
CYCc 259..467 CDD:214485 62/227 (27%)
Guanylate_cyc 311..469 CDD:278633 51/175 (29%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
gcy-18NP_502449.2 Periplasmic_Binding_Protein_Type_1 87..448 CDD:299141
ANF_receptor 87..395 CDD:279440
PKc_like 549..846 CDD:304357 3/15 (20%)
HNOBA <857..903 CDD:285003 15/50 (30%)
CYCc 882..1073 CDD:214485 62/221 (28%)
Guanylate_cyc 909..1095 CDD:278633 56/216 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.