DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and gcy-8

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_501324.2 Gene:gcy-8 / 177584 WormBaseID:WBGene00001535 Length:1152 Species:Caenorhabditis elegans


Alignment Length:395 Identity:95/395 - (24%)
Similarity:155/395 - (39%) Gaps:122/395 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 GDELA-PLPMYALFLCIHSMLP----------ISW------------PVSVVLALFMTAIHIVYR 200
            ||..| .|.||.:   |...||          :.|            |.:.||.:.::|: |...
 Worm   775 GDVYAFGLVMYEI---IFRALPFPEGTNQSELVEWLRDGSKVVKPTIPQNKVLNMDLSAL-IQDC 835

  Fly   201 IGTSPDYAPNLP--MLFGEIVMLASASVSGLYYRIMSDAAHN-RTVDGTRTGIEQRVKLECEREQ 262
            ..|:|:..|:|.  .|..|..:....|:.....|:|...|:| ..:...|||:     ||...::
 Worm   836 WNTTPEMRPSLRRIKLNVETYLNIKGSLVDQMTRMMEQYANNLEKLVAERTGM-----LEEANQR 895

  Fly   263 QEQLLLSVIPAYIAAEVK--RSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTILFADIVN 325
            .::||..::|||:|.|:|  |.:..|                         ..|:.|:||:|||.
 Worm   896 ADRLLSQLLPAYVANELKLGRPVPPK-------------------------TFTSSTVLFSDIVG 935

  Fly   326 FTPLSSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPISRPQHATNCVNMGL 390
            ||.:..:.:..::|..||.:|..|||........:::.:||.|..|||:|..             
 Worm   936 FTEMCQNASPLEVVAVLNGIFDGFDQFIARKDAYKVETIGDAYMVVSGVPEE------------- 987

  Fly   391 QMIDAIRHVREATGINVDM-------------------RIGIHTGNVLCGVLGLRKWQFDVWSDD 436
               :..||:.|...|.:|:                   |:|.|||.|...|:||...::.::.|.
 Worm   988 ---NGHRHINEIASIALDVHKFLSEFIVPHKRDTKVQCRLGFHTGPVAAAVVGLNAPRYCLFGDT 1049

  Fly   437 VTLANHMESGGVAGRVHITKQTLDFLGDKF---------EVE-QGEG---------------GNR 476
            |.:|:.|||....|:..|::...:.|..::         |:. :|:|               |..
 Worm  1050 VNMASRMESNSEPGKTQISETAKNLLLKEYPDYICEQRGEIPIKGKGLCMTYWLMGTKSEGSGRS 1114

  Fly   477 DAYLA 481
            .||||
 Worm  1115 GAYLA 1119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 41/157 (26%)
CYCc 259..467 CDD:214485 56/237 (24%)
Guanylate_cyc 311..469 CDD:278633 47/185 (25%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
gcy-8NP_501324.2 ANF_receptor 87..442 CDD:279440
Periplasmic_Binding_Protein_Type_1 94..434 CDD:299141
PKc_like 558..850 CDD:304357 19/78 (24%)
HNOBA <866..912 CDD:285003 15/50 (30%)
CYCc 891..1084 CDD:214485 56/233 (24%)
Guanylate_cyc 918..1105 CDD:278633 50/227 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.