DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and gcy-29

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_001364597.1 Gene:gcy-29 / 175116 WormBaseID:WBGene00007314 Length:1069 Species:Caenorhabditis elegans


Alignment Length:301 Identity:83/301 - (27%)
Similarity:139/301 - (46%) Gaps:47/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 PDYAPNL--PMLFGEIVMLASASVSGLYYRIMSDAAHN-RTVDGTRTGIEQRVKLECEREQQEQL 266
            ||..|.:  ..|..||.:....::.....|:|.:.|:| ..:.|.||.:.:...|..||     |
 Worm   789 PDMRPTIRRVRLATEIALKTKGNLVDSMMRMMEEYANNLEKLVGERTKLAEEANLRAER-----L 848

  Fly   267 LLSVIPAYIAAEVK--RSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTILFADIVNFTPL 329
            |..::|.::|.|:|  |::..||.|                         :.|::|:|||.||.|
 Worm   849 LFQLLPKHVAIELKAGRTVAPKMYD-------------------------SATVMFSDIVGFTKL 888

  Fly   330 SSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPISRPQ-HATN--CVNMGLQ 391
            .|:.|..::|..||.|:..||.:..::.|.:::.:||.|..|||:||...| |..|  .|.:|:.
 Worm   889 CSASTPIEVVNLLNKLYSEFDTVISKHDCYKVETIGDAYMVVSGIPIENGQRHVANISAVTLGIM 953

  Fly   392 MIDAIRHVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGVAGRVHITK 456
            .:..:..|.......:.:|:|..:|.|...|:||...::.::.:.|.:|..|||.|..|||.||:
 Worm   954 DLLKVFEVPHRRDYRLTIRLGFASGQVSAAVVGLSSPRYCLFGETVNIAAVMESSGEGGRVQITE 1018

  Fly   457 QTLDFLGDKFE--VEQGEGGNRD-------AYLADHKVESY 488
            .:...|.:::.  :.:..|.|:|       .|....|.|.|
 Worm  1019 TSKILLENEYPEFIIEIRGINKDVKQDDFVTYWLTGKDEDY 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 25/88 (28%)
CYCc 259..467 CDD:214485 62/212 (29%)
Guanylate_cyc 311..469 CDD:278633 50/162 (31%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
gcy-29NP_001364597.1 PBP1_NPR_GC-like 27..403 CDD:380575
PKc_like 534..804 CDD:419665 4/14 (29%)
CYCc 840..1033 CDD:214485 63/222 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.