DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and Gucy2d

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_001124165.1 Gene:Gucy2d / 14918 MGIID:106030 Length:1117 Species:Mus musculus


Alignment Length:509 Identity:117/509 - (22%)
Similarity:192/509 - (37%) Gaps:150/509 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SAARMNDALSASLADLSEQEN---GTTAEDIHLNDLY--TRYRQRLRKSLFRSGLLTSLLACVVS 97
            ||..:......||.||.:.||   ..|.:...|.||.  .||....|   |..|.|.| ..|||.
Mouse   625 SAMVLEHCARGSLEDLLQNENLRLDWTFKASLLLDLIRGLRYLHHRR---FPHGRLKS-RNCVVD 685

  Fly    98 --IIIGIV---YGQHL----------VQTMLLVLAALISGSILTALQFPAVLSSPAAALAFAIVT 147
              .::.|.   |.:.|          ....||..|             |.:|..|..|       
Mouse   686 TRFVLKITDHGYAEFLESHCSSRPQPAPEELLWTA-------------PELLRGPGKA------- 730

  Fly   148 TF--SLGTIAAITGDELAPLPMYALFLCIHSMLPISWPVSVVLALFMTAIHIVYRIGT------- 203
            ||  .:.::|.|..:.|...|.|.           ||.:|        |..|:.::.:       
Mouse   731 TFKGDVFSLAIILQEVLTRDPPYC-----------SWGLS--------AEEIIRKVASPPPLCRP 776

  Fly   204 ---------------------SPDYAPNLPMLFGEIVMLASASVSGL----------YYRIMSDA 237
                                 :||..|:|..::.:...:.....:.:          |...:.|.
Mouse   777 LVSPDQGPLECIQLMQLCWEEAPDDRPSLDQIYTQFKSINQGKKTSVVDSMLRMLEKYSESLEDL 841

  Fly   238 AHNRTVDGTRTGIEQRVKLECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSA 302
            ...||.:           ||.||.:.|:||..::|..:|..:|                ..:|..
Mouse   842 VQERTEE-----------LELERRKTERLLSQMLPPSVAHALK----------------MGTTVE 879

  Fly   303 TRFHELHVQRHTNVTILFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDC 367
            ..:.:       .|||.|:|||.||.:|:.....::|..||||:..||.:...:...:::.:||.
Mouse   880 PEYFD-------QVTIYFSDIVGFTTISALSEPIEVVGFLNDLYTLFDAVLDSHDVYKVETIGDA 937

  Fly   368 YYCVSGLP-ISRPQHATNCVNMGLQMIDAIRH--VREATGINVDMRIGIHTGNVLCGVLGLRKWQ 429
            |...|||| .:..:||....|:.|.::....:  :|.|..:.:.:|.|:|:|..:.||:||...:
Mouse   938 YMVASGLPRRNGNRHAAEIANLALDILSYAGNFRMRHAPDVPIRVRAGLHSGPCVAGVVGLTMPR 1002

  Fly   430 FDVWSDDVTLANHMESGGVAGRVHITKQTLDFL-----GDKFEVE-----QGEG 473
            :.::.|.|..|:.|||.|:..|:|:::.|:..|     |.|.:|.     :|:|
Mouse  1003 YCLFGDTVNTASRMESTGLPYRIHVSQSTVQALLSLDEGYKIDVRGQTELKGKG 1056

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 53/278 (19%)
CYCc 259..467 CDD:214485 60/215 (28%)
Guanylate_cyc 311..469 CDD:278633 51/165 (31%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
Gucy2dNP_001124165.1 PBP1_sensory_GC_DEF-like 71..445 CDD:380594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 529..557
PK_GC-2D 554..818 CDD:270945 48/235 (20%)
CYCc 855..1044 CDD:214485 57/211 (27%)
Interaction with NCALD. /evidence=ECO:0000250|UniProtKB:P51839 874..915 14/47 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1096..1117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.