DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and Gucy2c

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_001120790.1 Gene:Gucy2c / 14917 MGIID:106903 Length:1072 Species:Mus musculus


Alignment Length:294 Identity:76/294 - (25%)
Similarity:135/294 - (45%) Gaps:59/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 IEQRVKL-ECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRH 313
            :|:|.:| :.||::.:.|...::|..:...:|...:::                   .||:.:  
Mouse   778 VEERTQLYKAERDRADHLNFMLLPRLVVKSLKEKGIVE-------------------PELYEE-- 821

  Fly   314 TNVTILFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPI-S 377
              |||.|:|||.||.:....|..::|..|||::..||||...:...:::.:||.|...||||: :
Mouse   822 --VTIYFSDIVGFTTICKYSTPMEVVDMLNDIYKSFDQIVDHHDVYKVETIGDAYVVASGLPMRN 884

  Fly   378 RPQHATNCVNMGLQMIDAIR--HVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLA 440
            ..:||.:...|.|.::..|.  .:....|:.|.:|||:|:|....||:|::..::.::.|.|..|
Mouse   885 GNRHAVDISKMALDILSFIGTFELEHLPGLPVWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTA 949

  Fly   441 NHMESGGVAGRVHITKQTLDFLGDK-----FEVE-----QGEGGNRDAYLADHKVESYLIVPPKP 495
            :.|||.|:..|:|::..|:..|...     :||.     :|.|.....:|...|.:.|       
Mouse   950 SRMESTGLPLRIHMSSSTITILKRTDCQFLYEVRGETYLKGRGTETTYWLTGMKDQEY------- 1007

  Fly   496 AYTYSVPRVVECIEQNDPSPTTEETKEIKETDQS 529
                           |.|||.|.|.::..:|:.|
Mouse  1008 ---------------NLPSPPTVENQQRLQTEFS 1026

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 8/39 (21%)
CYCc 259..467 CDD:214485 58/215 (27%)
Guanylate_cyc 311..469 CDD:278633 52/165 (32%)
BASP1 510..667 CDD:283191 8/20 (40%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
Gucy2cNP_001120790.1 Periplasmic_Binding_Protein_Type_1 35..415 CDD:299141
PKc_like 480..749 CDD:304357
STYKc 502..744 CDD:214568
CYCc 787..978 CDD:214485 58/213 (27%)
Guanylate_cyc 814..1001 CDD:278633 58/209 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.