DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and gc2

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:XP_021333059.1 Gene:gc2 / 140425 ZFINID:ZDB-GENE-011128-8 Length:1120 Species:Danio rerio


Alignment Length:218 Identity:64/218 - (29%)
Similarity:114/218 - (52%) Gaps:32/218 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 EQRVKLECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRHTN 315
            |:..:||.|:::.|:||..::|..:|..:|                    ..|.....|.:   :
Zfish   841 ERTEELEIEKQKTEKLLTQMLPPSVAEALK--------------------LGTTVEPEHFE---S 882

  Fly   316 VTILFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPI-SRP 379
            |::.|:|||.||.:|::....::|..||||:..||.:...:...:::.:||.|...||:|: :..
Zfish   883 VSLYFSDIVGFTTISANSEPIEVVDLLNDLYTTFDAVIGNHDVYKVETIGDAYMVASGVPVPNGN 947

  Fly   380 QHATNCVNMGLQMIDAI-----RHVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTL 439
            :||....||.|.::.|:     ||:.:   :.|.:|||:|||..:.||:||...::.::.|.||.
Zfish   948 RHAAEIANMALDILSAVGTFRMRHMPD---VPVRIRIGLHTGPCVAGVVGLTMPRYCLFGDTVTT 1009

  Fly   440 ANHMESGGVAGRVHITKQTLDFL 462
            |:.|||.|:..|:|:...|:..|
Zfish  1010 ASRMESTGLPYRIHVHSSTVKIL 1032

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 10/37 (27%)
CYCc 259..467 CDD:214485 61/210 (29%)
Guanylate_cyc 311..469 CDD:278633 52/158 (33%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
gc2XP_021333059.1 PBP1_sensory_GC_DEF_like 59..440 CDD:107366
PK_GC-2D 551..815 CDD:270945
HNOBA <824..869 CDD:311573 9/27 (33%)
CYCc 848..1040 CDD:214485 61/211 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.