DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and gucy2f

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_571939.2 Gene:gucy2f / 140424 ZFINID:ZDB-GENE-011128-7 Length:1107 Species:Danio rerio


Alignment Length:347 Identity:93/347 - (26%)
Similarity:152/347 - (43%) Gaps:77/347 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 PDYAPNLPMLFGEIVMLASASVSGL----------YYRIMSDAAHNRTVDGTRTGIEQRVKLECE 259
            ||..|....:|.:..::.....:.:          |...:.|....||.:           ||.|
Zfish   797 PDRRPPFDQIFDQFKLINKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEE-----------LEVE 850

  Fly   260 REQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTILFADIV 324
            :::.|:||..::|..:|..:|..               ||.....|.:        |||.|:|||
Zfish   851 KQRTEKLLSEMLPPSVAEALKTG---------------ASVEPEYFDQ--------VTIYFSDIV 892

  Fly   325 NFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPISR-PQHATNCVNM 388
            .||.:||.....::|..||||:..||.:...:...:::.:||.|...||||... .:||....||
Zfish   893 GFTTISSLSDPIEVVDLLNDLYSLFDAVLGSHDVYKVETIGDAYMVASGLPKKNGNKHAAEIANM 957

  Fly   389 GLQMIDAI-----RHVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGV 448
            .|.::.::     ||:.|   :.|.:|||||:|..:.||:||...::.::.|.|..|:.|||.|:
Zfish   958 SLNILSSVGSFKMRHMPE---VPVRIRIGIHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGL 1019

  Fly   449 AGRVHI---TKQTLDFLGDKFEVE-------QGEGGNRDAYLADHKVESYLIVPPKPAYTYSVPR 503
            ..|:|:   |.|.|..|.|.::::       :|:|..          |:|.:| .|..:|..:|.
Zfish  1020 PYRIHVNISTVQILRSLNDGYKIDVRGKTELKGKGIE----------ETYWLV-GKANFTKPLPN 1073

  Fly   504 VVECIEQND--PSPTTEETKEI 523
            ..| |:..|  ....|||.|.:
Zfish  1074 PPE-IKPGDNWQDMMTEEIKSL 1094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 17/93 (18%)
CYCc 259..467 CDD:214485 68/216 (31%)
Guanylate_cyc 311..469 CDD:278633 58/166 (35%)
BASP1 510..667 CDD:283191 5/16 (31%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
gucy2fNP_571939.2 PBP1_sensory_GC_DEF_like 59..440 CDD:107366
PK_GC-2D 551..816 CDD:270945 4/18 (22%)
HNOBA <825..870 CDD:311573 12/55 (22%)
CYCc 850..1042 CDD:214485 68/217 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.