DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and AgaP_AGAP009087

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:XP_319835.4 Gene:AgaP_AGAP009087 / 1280041 VectorBaseID:AGAP009087 Length:924 Species:Anopheles gambiae


Alignment Length:518 Identity:98/518 - (18%)
Similarity:164/518 - (31%) Gaps:192/518 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 TASDLVK-TLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPISRPQHATNCVNMGLQMIDAIR 397
            ||:|.:| ||........|..|: :.:.:.:   |:...|.||.....:....|..|.:.|..:.
Mosquito   437 TANDYMKYTLLSAHRELKQRGQQ-EAVNVTL---CHIARSRLPTEAMSYLPQTVASGRKFILRVA 497

  Fly   398 HVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGVAGRVHITKQTLDFL 462
            .|.|::.:.:.     |...||                       :..|..|.::.        |
Mosquito   498 TVGESSAVLIK-----HNRCVL-----------------------LNKGSPARKLG--------L 526

  Fly   463 GDKFEVEQGEGGNRDAYLADHKVESYLIVPPKPAY-TYSVPRVVECIEQNDPSPTTEE-----TK 521
            ...|.|...:...::..|.|  .:.||::..:..: ..::..|.|.|.:       ||     .|
Mosquito   527 SANFPVTVPDPEVQEVVLTD--ADEYLVLGNRKLWEVITMETVAEEIRK-------EENILLAAK 582

  Fly   522 EIKETDQSHEA---------------TDVADVL---LPVTVAPPPAIV----------------- 551
            .:::..||:.|               ||| |.|   |..|:...|.::                 
Mosquito   583 RVQDIAQSYGAEENLSVMIVRFNNLGTDV-DFLMRELRQTIRKKPTLIQGGTGVISGFCKCGCCC 646

  Fly   552 ----------------------DEKMSPT-----SINSQEAPLHAPLASAASMSIKELSEEEDEA 589
                                  .::.||:     :..|:...||....|..|...|| .|..||:
Mosquito   647 ETNNSCCHSAAAVQFVRHPSGRSDRSSPSGQSDQTSGSETVTLHGLPRSKVSDEEKE-REGMDES 710

  Fly   590 DEATAV-------------TEPLMHRD-----------------QDGKNDKEPKANGGHRGSGDS 624
            |.|.:.             |:.|..::                 .:|.::....::|....||.|
Mosquito   711 DSAMSEEQFKCWEYMLEQNTQLLFDKELNTISRGFVGKRTGVTATNGTSESGTNSSGSSGSSGAS 775

  Fly   625 AASESVAKSAALSLPADDLLSMSGSESGISNSGAQAQSS---NPASVTPTAAAPAGG------AA 680
            ..::...|:.:.|.|.   |:...|:||:::|.|...|.   ..|..||..:...|.      |:
Mosquito   776 NLTKLQLKNLSTSSPQ---LAQLESDSGLNSSLASGYSGTMMTTARATPFLSKQFGSTRSFHPAS 837

  Fly   681 SNSL-------TVAEAPERSRRKL----------SVQGLM---------SFADRRRSSGAFIE 717
            |.|.       |.|..|    |.:          |:|.||         |..||..|:|..:|
Mosquito   838 SQSYFKPIQYSTPATRP----RPINTGPNAAYFGSLQRLMPYNLEFDGASVQDRYGSNGNVLE 896

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831
CYCc 259..467 CDD:214485 23/133 (17%)
Guanylate_cyc 311..469 CDD:278633 24/135 (18%)
BASP1 510..667 CDD:283191 45/256 (18%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
AgaP_AGAP009087XP_319835.4 leucine-rich repeat 20..50 CDD:275380
leucine-rich repeat 51..82 CDD:275380
LRR_8 59..116 CDD:290566
LRR_4 81..121 CDD:289563
leucine-rich repeat 83..105 CDD:275380
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 131..152 CDD:275380
LRR_8 154..235 CDD:290566
leucine-rich repeat 154..177 CDD:275380
LRR_RI <171..335 CDD:238064
leucine-rich repeat 178..200 CDD:275380
leucine-rich repeat 201..224 CDD:275380
LRR_8 223..282 CDD:290566
leucine-rich repeat 225..248 CDD:275380
leucine-rich repeat 249..271 CDD:275380
LRR_8 271..326 CDD:290566
leucine-rich repeat 272..293 CDD:275380
leucine-rich repeat 294..320 CDD:275380
PP2Cc 398..602 CDD:214625 38/213 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.