DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and LRRK2

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_940980.4 Gene:LRRK2 / 120892 HGNCID:18618 Length:2527 Species:Homo sapiens


Alignment Length:749 Identity:141/749 - (18%)
Similarity:251/749 - (33%) Gaps:248/749 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 QRVKLE--CEREQQEQLLLS------------VIPAYIAAEVKRSIMLK-------------MAD 289
            |::.|:  .::.::..||::            :.|..|.|::.|:|||.             :.|
Human  1823 QKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGD 1887

  Fly   290 ACQRAGGQASTSATRFHELHVQ---RHTNVTILFADIVNFT----PLSSSLTASD-----LVKTL 342
            .   :.|....:|....|:.|:   :||::.:|..::|...    |...||.|:.     ||..|
Human  1888 G---SFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMEL 1949

  Fly   343 NDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPISRPQHATNCVNMGLQMIDAIRHVREATGINV 407
            ... |..|::.|:::....:.|               ||     .:.|.:.|.:|::..|..|..
Human  1950 ASK-GSLDRLLQQDKASLTRTL---------------QH-----RIALHVADGLRYLHSAMIIYR 1993

  Fly   408 DM------------------------------RIGIHTGNVLCGVLGLR-----------KWQFD 431
            |:                              |:||.|..   |..|.|           ..|.|
Human  1994 DLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSE---GTPGFRAPEVARGNVIYNQQAD 2055

  Fly   432 VWSDDVTLANHMESGG--VAGRVHITKQTLDFLGDKFEVE-QGEGGNRDAYLADHKVESYLIVPP 493
            |:|..:.|.:.:.:||  |.|        |.|..:..|:| ||:       |.| .|:.|...| 
Human  2056 VYSFGLLLYDILTTGGRIVEG--------LKFPNEFDELEIQGK-------LPD-PVKEYGCAP- 2103

  Fly   494 KPAYTYSVPRVVECIEQN-DPSPTTEETKEIKETDQSHEATDVADVLLPVTVAPPPAIVDEKMSP 557
               :......:.:|:::| ...||:.:..:|..:.:.        |.|...:..|..::.|.|..
Human  2104 ---WPMVEKLIKQCLKENPQERPTSAQVFDILNSAEL--------VCLTRRILLPKNVIVECMVA 2157

  Fly   558 TSINSQEAPL-----HAPLASAASMSIKELSEEEDEADEATAVTEPLMH---------------- 601
            |..||:.|.:     |......:.:.:.......:|..::..:...|:|                
Human  2158 THHNSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSG 2222

  Fly   602 -----RDQDGK--NDKEPKANGGHRGSGDSAASESVAKSAALSLPADDLLSMSGSESGISNSGAQ 659
                 ..:|||  :..|...:.......:|.:.:|..|:..|...||..|::. .:..:...|| 
Human  2223 TLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIF-EDKTVKLKGA- 2285

  Fly   660 AQSSNPASVTPTAAAPAGGAASNSLTVAEAPERSRRKLSVQG----LMSFADRRRSSGAF----- 715
                     .|......|..::..:.::|:...:.|.:...|    :.||      |..|     
Human  2286 ---------APLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSF------SNDFTIQKL 2335

  Fly   716 IEGRKLSIHSGESFRSHAGHVT-----------RNRPSSKMTKYVECWGADRPFANIAESKLVKN 769
            ||.|...:.|..:| |.:..:|           :|.|      .||.|          :.|..|.
Human  2336 IETRTSQLFSYAAF-SDSNIITVVVDTALYIAKQNSP------VVEVW----------DKKTEKL 2383

  Fly   770 IGLASIAMIESNLLPPERK--CFNFNFFGPPTELKPFTMWYRNTPREAMYRAQPDTHFRFDLICA 832
            .||.........::..|.|  ....::.|   .:|...: .:||   |::......|        
Human  2384 CGLIDCVHFLREVMVKENKESKHKMSYSG---RVKTLCL-QKNT---ALWIGTGGGH-------- 2433

  Fly   833 FVLFLSLAVVQLIVIELNL---------ALLGSL 857
             :|.|.|:..:||.:..|.         |.||||
Human  2434 -ILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSL 2466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 11/63 (17%)
CYCc 259..467 CDD:214485 55/287 (19%)
Guanylate_cyc 311..469 CDD:278633 42/212 (20%)
BASP1 510..667 CDD:283191 30/185 (16%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
LRRK2NP_940980.4 Required for RAB29-mediated activation. /evidence=ECO:0000269|PubMed:29212815 1..969
LRR 1 983..1004
leucine-rich repeat 985..1012 CDD:275380
LRR 1012..>1286 CDD:227223
LRR 2 1012..1033
leucine-rich repeat 1013..1036 CDD:275380
LRR 3 1036..1057
leucine-rich repeat 1037..1084 CDD:275380
LRR 4 1059..1080
LRR 5 1084..1105
leucine-rich repeat 1085..1108 CDD:275380
LRR 6 1108..1129
leucine-rich repeat 1109..1130 CDD:275380
LRR 7 1130..1150
leucine-rich repeat 1131..1174 CDD:275380
LRR 8 1174..1196
leucine-rich repeat 1175..1197 CDD:275380
LRR 9 1197..1218
leucine-rich repeat 1198..1221 CDD:275380
LRR 10 1221..1241
leucine-rich repeat 1222..1246 CDD:275380
LRR 11 1246..1267
leucine-rich repeat 1247..1269 CDD:275380
LRR 12 1269..1291
RocCOR 1334..1507 CDD:206741
COR 1527..1740 CDD:318343
STKc_LRRK2 1884..2135 CDD:270970 60/297 (20%)
WD 1 2139..2183 9/43 (21%)
WD 2 2188..2228 3/39 (8%)
WD 3 2233..2276 9/43 (21%)
WD 4 2281..2327 9/61 (15%)
WD 5 2333..2377 12/60 (20%)
WD 6 2402..2438 8/51 (16%)
WD 7 2443..2497 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.