DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and AgaP_AGAP012965

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:XP_003436066.1 Gene:AgaP_AGAP012965 / 11175716 VectorBaseID:AGAP012965 Length:555 Species:Anopheles gambiae


Alignment Length:99 Identity:25/99 - (25%)
Similarity:40/99 - (40%) Gaps:29/99 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   857 LLASFVSLALFLYL-SNMSVP--------DVHASTTERNGPGQVVASSRYLRLAMFVVVNILISS 912
            |||:..:.||.|.| ||:.:|        .:.:|..:.||...::.||              |:|
Mosquito    84 LLATDANRALSLALASNLHIPYTIAMDATSIPSSFNDSNGKVVIICSS--------------INS 134

  Fly   913 CAVFSVINYTVPDGVSKEPSSNQTILESNFSSVF 946
            ....||||..      |:.|..:.:|.....::|
Mosquito   135 PQTISVINQL------KQYSRTKILLLDLVGTIF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831
CYCc 259..467 CDD:214485
Guanylate_cyc 311..469 CDD:278633
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
AgaP_AGAP012965XP_003436066.1 ANF_receptor 12..>175 CDD:279440 25/99 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.