DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and gucy1b1

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:XP_004911214.1 Gene:gucy1b1 / 100379900 XenbaseID:XB-GENE-950986 Length:618 Species:Xenopus tropicalis


Alignment Length:279 Identity:77/279 - (27%)
Similarity:126/279 - (45%) Gaps:67/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 IVMLASASV--------SGLYYRIMSD-AAHNRTVDGTRTGIEQRVK------------------ 255
            |:.|.|.||        .|||   :|| ..|:.|.|....|.:.|.:                  
 Frog   319 ILFLCSPSVMNLDDLTRRGLY---LSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTL 380

  Fly   256 --LECEREQQEQLLLSVIPAYIAAEV--KRSIMLKMADACQRAGGQASTSATRFHELHVQRHTNV 316
              ||.|:::.:.||.||:|..:|.|:  ||.:..|                         |:.||
 Frog   381 RALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAK-------------------------RYDNV 420

  Fly   317 TILFADIVNFTPLSSSLTASD----LVKTLNDLFGRFDQIAQENQ---CLRIKILGDCYYCVSGL 374
            ||||:.||.|....|...:.:    :|..|||::.|||.:.....   ..:::.:||.|..|||:
 Frog   421 TILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGI 485

  Fly   375 PISRPQHATNCVNMGLQMIDAIRHVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTL 439
            |.....||.:..::.|.|::....| :..|.:|.:.||||||.|:.||:|.|..::.::.:.|.|
 Frog   486 PEPCVHHARSICHLALDMMEIAGQV-QVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNL 549

  Fly   440 ANHMESGGVAGRVHITKQT 458
            .:..|:.|..|::::::.|
 Frog   550 TSRTETTGEKGKINVSEYT 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 28/101 (28%)
CYCc 259..467 CDD:214485 60/209 (29%)
Guanylate_cyc 311..469 CDD:278633 49/155 (32%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
gucy1b1XP_004911214.1 HNOB 2..166 CDD:377902
HNOBA 207..406 CDD:369471 24/89 (27%)
Guanylate_cyc 412..605 CDD:306677 50/183 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.