DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and gucy2g

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:XP_009305067.2 Gene:gucy2g / 100333350 ZFINID:ZDB-GENE-130531-70 Length:1127 Species:Danio rerio


Alignment Length:430 Identity:105/430 - (24%)
Similarity:178/430 - (41%) Gaps:127/430 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 PL-PMYALFLCIHSMLPI---SWPVSVVLALFMTAIHIVYRIGTSPDYAPNLPMLFGEIVMLASA 224
            || |..:..:|...::|:   .|                   ..:||:.|.    ||.|      
Zfish   771 PLRPTLSADICDERLIPLIKACW-------------------SENPDHRPP----FGSI------ 806

  Fly   225 SVSGLYYRIMSDA---AHNRTVDG-----------TRTGIEQRV-KLECEREQQEQLLLSVIPAY 274
                  .|.:.||   :|...:|.           ....:|:|. :|..|:.:.::||.|::|.|
Zfish   807 ------RRQLRDACPESHANILDNMVNKLEKYANHLEEVVEERTSQLTVEKSRADKLLSSMLPRY 865

  Fly   275 IAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTILFADIVNFTPLSSSLTASDLV 339
            ||.::       ||         ..:...|.:|:       |||.|:|||.||.:.|..:|.::|
Zfish   866 IADQL-------MA---------GKSVEPRSYEM-------VTIFFSDIVGFTTMCSVSSALEVV 907

  Fly   340 KTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPISR-PQHATNCVNMGLQMIDAIRH--VRE 401
            ..||||:..||.|.:.....:::.:||.|...||||||. ..||.....|.|..:.:|:.  :|.
Zfish   908 TLLNDLYSLFDDIIKLYDVYKVETIGDAYMVASGLPISNGTLHAEEISTMALHFLSSIKRFKIRH 972

  Fly   402 ATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGGVAGRVHITKQTLDFL---G 463
            .....:.:||||::|.|:.||:|....::.::.|.|..|:.|||..:..::||::.|.|.|   |
Zfish   973 LPNERLALRIGINSGPVVAGVVGSTMPRYCLFGDTVNTASRMESNSLPLKIHISQSTADILLTIG 1037

  Fly   464 DKFEVEQ-------GEGGNRDAYLADHKVESYLIVPPKPAYTYSVPRVVECIEQNDPSPTT---- 517
             .||:|:       |:|..:..:|..           ||.:|:....     :.::|||.:    
Zfish  1038 -TFELEERGDIEIKGKGTQKTFWLLS-----------KPGFTFPPTG-----QDSNPSPKSGTDS 1085

  Fly   518 ----------------EETKEIKETDQSHEATDVADVLLP 541
                            :|.:.|:.|....:.||:..:.:|
Zfish  1086 CHIKQEKTKAANDGDFKERRTIQRTSAMTKMTDMYTLTVP 1125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 29/143 (20%)
CYCc 259..467 CDD:214485 67/213 (31%)
Guanylate_cyc 311..469 CDD:278633 57/163 (35%)
BASP1 510..667 CDD:283191 9/52 (17%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
gucy2gXP_009305067.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.