DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and gucy1b1

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_001238874.1 Gene:gucy1b1 / 100150304 ZFINID:ZDB-GENE-090313-160 Length:608 Species:Danio rerio


Alignment Length:350 Identity:86/350 - (24%)
Similarity:141/350 - (40%) Gaps:117/350 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 IVMLASASV--------SGLYYRIMSD-AAHNRTVDGTRTGIEQRVK------------------ 255
            |:.|.|.||        .|||   :|| ..|:.|.|....|.:.|.:                  
Zfish   319 ILFLCSPSVMNLDDLTRRGLY---LSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTL 380

  Fly   256 --LECEREQQEQLLLSVIPAYIAAEV--KRSIMLKMADACQRAGGQASTSATRFHELHVQRHTNV 316
              ||.|:::.::||.||:|..:|.|:  ||.:..|                         |:.||
Zfish   381 RALEDEKKKTDRLLYSVLPPSVANELRHKRPVPAK-------------------------RYDNV 420

  Fly   317 TILFADIVNFTPLSSSLTASD----LVKTLNDLFGRFDQIAQENQ---CLRIKILGDCYYCVSGL 374
            ||||:.||.|....|...:::    :|..|||::.|||.:....:   ..:::.:||.|..||||
Zfish   421 TILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGL 485

  Fly   375 PISRPQHATNCVNMGLQMIDAIRHVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTL 439
            |.....||.:..::.|.|::....|: .....|.:.||||||.|:.||:|.|..::.::.:.|.|
Zfish   486 PEPCTHHAKSICHLALDMMEIAGQVK-VDEDPVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNL 549

  Fly   440 ANHMESGGVAGRVHITKQTLDFLGDKFEVEQGEGGNRDAYLADHKVESYLIVPPKPAYTYSVPRV 504
            .:..|:.|..|::::::                                        |||   |.
Zfish   550 TSRTETTGEKGKINVSE----------------------------------------YTY---RC 571

  Fly   505 VECIEQNDP-------SPTTEETKE 522
            ::.:|..||       .|.|.:.|:
Zfish   572 LQSVENADPQFHLEYRGPVTMKGKK 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 28/101 (28%)
CYCc 259..467 CDD:214485 59/216 (27%)
Guanylate_cyc 311..469 CDD:278633 48/164 (29%)
BASP1 510..667 CDD:283191 5/19 (26%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
gucy1b1NP_001238874.1 HNOB 2..166 CDD:285002
HNOBA 207..406 CDD:285003 24/89 (27%)
CYCc 385..584 CDD:214485 66/267 (25%)
Guanylate_cyc 412..605 CDD:278633 59/253 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.