DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac76E and gucy1a2

DIOPT Version :9

Sequence 1:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster
Sequence 2:NP_001120379.1 Gene:gucy1a2 / 100145454 XenbaseID:XB-GENE-1011801 Length:712 Species:Xenopus tropicalis


Alignment Length:510 Identity:118/510 - (23%)
Similarity:188/510 - (36%) Gaps:152/510 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 AALISGSILTALQFPAVL--SSPAAALAFAIVTTFSLGTIAAITGDELAPLPMYALFLC-IHSML 178
            |.|:...:|.:...|:.|  |......||.....|....:....|:.|.     .|..| :|..:
 Frog   279 ANLMKAPLLQSSHIPSDLRISISTFCRAFPFHLMFDPNMLILQLGEGLR-----KLIKCEVHKTM 338

  Fly   179 P-------ISWPVSVVLALFMTAIHIVYRIGTSPDYAPNL-----------PMLF----GEIVML 221
            .       :|..:|......:..:...:.|...|| ||..           .|::    ..|:.|
 Frog   339 QFHDSFEIVSPKISCTFEQVLLRLSTPFVIRNKPD-APTFENKDKVMEVKGQMIYVPESSSILFL 402

  Fly   222 ASASVS--------GLYYRIMSD-AAHNRTVD--------GTRTGIEQRV------------KLE 257
            .|..|.        ||:   :|| ..|:.|.|        ..:.|:::|:            .||
 Frog   403 GSPRVDKLDELMGRGLH---LSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLEKTHQALE 464

  Fly   258 CEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQRHTNVTILFAD 322
            .|:::...||.|:.|               .|..|:.....|..|.:|.:        ||:||:|
 Frog   465 EEKKKTVDLLYSIFP---------------GDVAQQLWEGKSVQARKFDD--------VTMLFSD 506

  Fly   323 IVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQC-----LRIKILGDCYYCVSGLPISRPQHA 382
            ||.||.:.:..|...::..||:|:.|||.     ||     .:::.:||.|...:||......||
 Frog   507 IVGFTAVCAQCTPMQVISMLNELYTRFDY-----QCGFLDIYKVETIGDAYCVAAGLLRQSNSHA 566

  Fly   383 TNCVNMGLQMIDAIRHVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTLANHMESGG 447
            .....|.|:|::....|....|..:.||||||:|:||.||:|:|..::.::.::||||:..|||.
 Frog   567 KPIALMALKMMELSEEVLTPDGRPIKMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGS 631

  Fly   448 VAGRVHITKQTLDFLGDKFEVEQGEGGNRDAYLADHKVESYLIVPPKPAYTYSVPRVVECIEQND 512
            ...|::::..|...|.|:                              |..:.|||..|.:..|.
 Frog   632 HPRRINVSPTTYQLLKDE------------------------------ANFHFVPRSREELPDNF 666

  Fly   513 PSPTTEETKEIK------ETDQSHEATDVADVLLPVTVAPPPAIVDEKMSPTSIN 561
            |       |||.      |.|...:             .|.|::...:|...|.|
 Frog   667 P-------KEIPGICYFLEADSGQK-------------QPKPSLTSVRMRKVSYN 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 42/225 (19%)
CYCc 259..467 CDD:214485 64/212 (30%)
Guanylate_cyc 311..469 CDD:278633 54/162 (33%)
BASP1 510..667 CDD:283191 12/58 (21%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
gucy1a2NP_001120379.1 Pap_E4 30..>86 CDD:367150
HNOB <132..248 CDD:377902
HNOBA 296..486 CDD:369471 40/213 (19%)
Guanylate_cyc 492..679 CDD:306677 66/236 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.